SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007370 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007370
Domain Number 1 Region: 80-257
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.9e-31
Family Pentraxin (pentaxin) 0.0016
Further Details:      
 
Domain Number 2 Region: 581-867
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000494
Family Rhodopsin-like 0.025
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000007370
Domain Number - Region: 2-51
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00143
Family C-type lectin domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007370   Gene: ENSTGUG00000007153   Transcript: ENSTGUT00000007443
Sequence length 872
Comment pep:known_by_projection chromosome:taeGut3.2.4:17:10610088:10624338:1 gene:ENSTGUG00000007153 transcript:ENSTGUT00000007443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDWWQADRYCEQHFAQLLLEPQDSEQGSLSKLLQSHHIRGSVWIKERDSVLHKTKRRRGH
TVPVSGVPRQNRHKYVKVLFCLPGLPAVTACAHLQWDTSTQEIATIFSYAVPAFMNEFQL
RGFVDEEGFVRFALIVHGHHSPYLPVFRADGQWHHFCVTWQQENGTWAIYADGKRRASAS
GLCPVGPSAPQAIFGQGTFIIGQDQDSLGGTFRAKESFSGNITDLHIWQKALSPEHIEKV
RSCGVVEQDLVFGWSSNALEVERTVQAVATRLLCPGPVEECRVLEVGSSGFSYASCLQTL
PFICHYSKDAYWQLKRAQQESSHSLARRVNSLAASTVQIPDSVFTSGVQDMNLSVALDAL
DILATVLREEVPMLEPTDLLAVLQLLKQVSDLEIQEGDELEMLEQLGQYYMEVTESILAE
QNTGTWSSISQVIRGPMAVVELCDRMVSLLVPLLTTERTKITIQHGNIGLHRVTVKNMWF
GYGSLQRCLSSSGTSAVSQGTAAPDGGQKYLSTTVGTAVISSTLLGEDQEISTAVRYRLQ
HRVQVPPGAFSLVLLHISPDAGGMWSTAGCSVAKSLPDSTACFCNHSTNFAILLQVHDMQ
RTTKEEFMLQTLTFIGCGVSFCALTATFILFLVVRVPKSERTTVHKNLILALAAGEALLM
FSELAKSNQVLCFMVTAFLHLFFMAAFSWMLVEGLLLWSKVVAVNMSEGRRMKFYYVTGW
GLPVLIVGVTLATSFNKYVASNHCWLNVQTNVIWAFVGPVLFILAVNSFVLLRVVTVTVA
SARRRSKMLTPNSSLENQMGTQLWATAKPVLVLLPVLGLTWLCGLLVPLSIVWAYVFVVL
NSLQGLYIFLVYAIYNSEVRNAIQRMKDKKKA
Download sequence
Identical sequences H0Z9W7
ENSTGUP00000007370 59729.ENSTGUP00000007370 ENSTGUP00000007370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]