SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007372 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007372
Domain Number 1 Region: 5-132
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000209
Family Cadherin 0.0026
Further Details:      
 
Domain Number 2 Region: 150-249
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000118
Family Cadherin 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000007372
Domain Number - Region: 243-283
Classification Level Classification E-value
Superfamily Cyclophilin-like 0.0506
Family Cyclophilin (peptidylprolyl isomerase) 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007372   Gene: ENSTGUG00000007156   Transcript: ENSTGUT00000007445
Sequence length 290
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:7434481:7438789:-1 gene:ENSTGUG00000007156 transcript:ENSTGUT00000007445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEILVTILNENDNYPVFPQPNITRDVPEATEVDTTIVAREEVTATDADLDIIYYELNTTV
QNTDGYFAIRGVNNPEIYLQKALDYDKFNSTTLLLYARDRPENSPEPTNTATATITISIK
QSDTRAPWFLPCTQLYNDTSVCISSPYSGRVNISEKLTDPLLLEPGPIYAVDPDYTISDR
IVYSIVGGNTDEVFSMDANTGNLTMNKTVTSPGSFLLQVMATQASNIRKYSVATVVIKVI
NKSNFPPYFEKGVYNGTVFVGLPQRSFVYQAGDPSTPLVIMAMDEDFPDV
Download sequence
Identical sequences H0Z9W9
59729.ENSTGUP00000007372 ENSTGUP00000007372 ENSTGUP00000007372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]