SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007382 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007382
Domain Number 1 Region: 185-268
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.44e-22
Family Thyroglobulin type-1 domain 0.0000457
Further Details:      
 
Domain Number 2 Region: 36-117
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.63e-21
Family Growth factor receptor domain 0.0000735
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007382   Gene: ENSTGUG00000007176   Transcript: ENSTGUT00000007457
Sequence length 273
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:77709392:77715894:1 gene:ENSTGUG00000007176 transcript:ENSTGUT00000007457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCALCRGWLPALLLPPLLLQLPALPAARIARAAQPVLCAPCTPERLALCPPVPPDCPEAA
RQPGCGCCQICALGPGQPCGVYTARCRLGLRCHIPTGESRPLSALIQGHGTCLPASEVGR
MRTEEPADSIEPDDMPLESTEITQDQLLNYQLMFPIGQDKSVPWNSISTYEYMKAKRISE
LNKLKEQGPCQKELYRSLYTLVKAQQRSRGEIYKFYLPNCNRNGFYHSKQCETLLDGESA
ECWCVYPKNGRRIPGSPKIKGDPECQQYLSSQE
Download sequence
Identical sequences H0Z9X9
59729.ENSTGUP00000007382 ENSTGUP00000007382 ENSTGUP00000007382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]