SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007392 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007392
Domain Number 1 Region: 128-210
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.22e-25
Family Thyroglobulin type-1 domain 0.00022
Further Details:      
 
Domain Number 2 Region: 1-40
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000173
Family Growth factor receptor domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007392   Gene: ENSTGUG00000007179   Transcript: ENSTGUT00000007467
Sequence length 214
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:77723161:77737199:-1 gene:ENSTGUG00000007179 transcript:ENSTGUT00000007467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAACGIYTERCGAGLSCQPWREEARPLQALLEDRGLCNNATAGSKLRAFLLPGPHAAGNF
SASEEDSSTSSIENQAIPNSHRVPDSKSHPPHIKVDIIRKVQAKDTQRYKVEYDSQRTDT
LNFSSESKQGTEYGPCRREMEDTLNHLKILNVLSPRGFHIPNCDKKGFYKKKQCRPSKGR
KRGYCWCVDKYGQPLPGYDGKGNGDVHCYNLESK
Download sequence
Identical sequences H0Z9Y9
ENSTGUP00000007392 ENSTGUP00000007392 59729.ENSTGUP00000007392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]