SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007477 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007477
Domain Number 1 Region: 152-260
Classification Level Classification E-value
Superfamily Cadherin-like 1.03e-26
Family Cadherin 0.00024
Further Details:      
 
Domain Number 2 Region: 378-481
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 261-376
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-21
Family Cadherin 0.00094
Further Details:      
 
Domain Number 4 Region: 481-589
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-20
Family Cadherin 0.0023
Further Details:      
 
Domain Number 5 Region: 82-159
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000528
Family Cadherin 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007477   Gene: ENSTGUG00000007189   Transcript: ENSTGUT00000007554
Sequence length 790
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:78818652:78988549:1 gene:ENSTGUG00000007189 transcript:ENSTGUT00000007554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRITSTSCICPVLVCLCFVQRCYGAAHHGSIKVTRNQTKHIEGETEVHHRPKRGWVWNQF
FVLEEHMGPDPQYVGKLHSNSDKGDGSVKYILTGEGAGTIFIIDDTTGDIHSTKSLDREQ
KTHYVLHAQAIDRRTNKPLEPESEFIIKVQDINDNAPKFTDGPYIVTVPEMSEMGTSVLQ
VTATDADDPTYGNSARVVYSILQGQPYFSVDPKTGVIRTALHNMDREAREHYSVVIQAKD
MAGQVGGLSGSTTVNITLTDVNDNPPRFPQKHYQLYVPESAQVGSAVGKIKANDADTGSN
ADMKYTIINGNGSGVFSITTDKETREGILSLKKPLNYEKKKSYTLNIEGANTHLDFRFSH
LGPFKDVTMLKVIVGDVDEPPLFTMPFYVMEVYENAKIGTPVGTVTAHDPDAANSLVRYF
IDHNTEEDRYFTIDASTGTIKTAKIFDREETPWYNITVAASEIDNPGLVSHVPVGVRILD
VNDNPPELARDYDVVICENTKPGQVIQTITATDKDDSANGARFHFSLDEGLSLNPNFTLR
NNEDNTASILTKRRRYSRTSQDIYYLPVLISDGGMPPLSSSSTLTIRVCACERDGRVRTC
HAEALLSSAGLSTGALIAILLCIVILLAIVVLFITLRRSKKEPLIISEEDVRENVVTYDD
EGGGEEDTEAFDITALRNPSAAEELKYRRDVHPEVKPLSRHHPSSSLDSIDVQEFLNQRL
AEADLDPSVPPYDSLQTYAYEGHRSEGGSISSLDSATTHSDQDYNYLGDWGPEFKKLAEL
YGEVEPERTT
Download sequence
Identical sequences H0ZA74
ENSTGUP00000007477 XP_002195575.1.42559 ENSTGUP00000007477 59729.ENSTGUP00000007477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]