SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007560 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007560
Domain Number 1 Region: 2-191
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.3e-66
Family Glutathione peroxidase-like 0.000000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007560   Gene: ENSTGUG00000007332   Transcript: ENSTGUT00000007637
Sequence length 192
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:13019387:13025258:-1 gene:ENSTGUG00000007332 transcript:ENSTGUT00000007637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVSKPAPYWEGTAVINGEFKELKLTDYEGKYLVFFFYPLDFTFVCPTEIIAFSDRIEEFR
AINTEVVACSVDSKFTHLAWINTPRKQGGLGPMKIPLLSDLTHQISKDYGVYLEDQGHTL
RGLFIIDNKRILRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPD
PAGKLKYFDKLN
Download sequence
Identical sequences H0ZAF6
ENSTGUP00000007560 59729.ENSTGUP00000007560 ENSTGUP00000007560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]