SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007574 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007574
Domain Number 1 Region: 39-790
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.52e-265
Family Motor proteins 0.000000000122
Further Details:      
 
Domain Number 2 Region: 1214-1310
Classification Level Classification E-value
Superfamily PH domain-like 1.71e-28
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 1393-1514
Classification Level Classification E-value
Superfamily PH domain-like 8.04e-22
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Domain Number 4 Region: 1795-1865,1908-1952
Classification Level Classification E-value
Superfamily Second domain of FERM 2.44e-19
Family Second domain of FERM 0.007
Further Details:      
 
Domain Number 5 Region: 1330-1385
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000218
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 6 Region: 1174-1214
Classification Level Classification E-value
Superfamily PH domain-like 0.000000236
Family Pleckstrin-homology domain (PH domain) 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000007574
Domain Number - Region: 817-922,1216-1241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00293
Family BAR domain 0.048
Further Details:      
 
Domain Number - Region: 1956-2042
Classification Level Classification E-value
Superfamily PH domain-like 0.0184
Family Third domain of FERM 0.03
Further Details:      
 
Domain Number - Region: 1700-1789
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0491
Family Ras-binding domain, RBD 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007574   Gene: ENSTGUG00000007271   Transcript: ENSTGUT00000007652
Sequence length 2060
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:80023565:80149953:1 gene:ENSTGUG00000007271 transcript:ENSTGUT00000007652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGSRVWLRENNQHYPTTVHSCAEGVVVFKTDYGQVFTYKQSTITHQKVTPMHQTSTESVE
DMAALVDLHEGSIMHNLFQRYQQDKIYTYIGSIVTSVNPYKSIPGLYDCAAMERYSKHHM
GEISPHIFAVANECYRCLWKRRDNQCILISGESGAGKTESTKLILKFLSSMSQHSLELSS
REKTSCVEQAILESSPIMEAFGNAKTVYNNNSSRFGKFIQLNICQKGNIQGGRIMDYLLE
KNRVVRQNPGERNYHIFYALLAGIEEREKDAFYLSVPENYNYLNQSGCIVDKTISDKDSF
KEVITAMEVMEFSREEVREILRLLAGILHLGNVEFITAGGAQVSFKTALGQSAELLGLDS
AQLTEALTQRSMILRGEEILTPLSIQQAIDSRDSMAMALYSQCFAWVIKKINSRIRSKED
FKTIGILDIFGFENFEINHFEQFNINYANEKLQEYFNKHIFSLEQLEYSREGLIWEDIDW
TDNGECLDLIEKKLGLLALINEESHFPQATDCTLLEKLNAQHANNPFYVKPRVAVHNFGV
KHYAGEVQYDVRGILEKNRDTFRDDLLNLLRESSIDFIYDLFEHVSSRNNKDTLKCGSKH
RKPTVSLQFKESLHSLMATLSSSNPFFVRCIKPNVQKMPDQFDQTVVLNQLRYSGMLETV
RIRRAGFPVRRPFQDFYKRYKVLMRNLTLPEDLNEKCANLLRLYDNTSTEWQLGKNKVFL
RESLEHKLEKQREVEVTKAAMIVRAHILGYAARKHYRKVLYYVVVIQKNYRAFSGRKKFL
CLKKAATVLQKQRRGQLARRLYRERLEEKRRQEEERRKEEEERCTKECNELMERQRQEAE
RLAQQAEEERKKQELAAIQKAQKEAELKQEVEKQKESRQVEEILRLEKEIEDLQRVKKQQ
ELSLTEASLQRLQQRRDEELRRLEDEACRAAQEFLESLNFDEIDECVRNIERSLSVGSGY
PAELAEQTGNACSEKPNFNFSQPYPEEEVDEGFEADNDAFKDSPNPSEHGHSDQRTSGIR
TSDDSSEEDPYMNDTVVPTIPAASDAMVIPPAHDTVSLHNSSSGESTYCMPENISCRPPD
SVELISPDGDYDYDQDDYEDGAITSGSSVTFSNSHSSQWSPDYRCSVGTYNSSGAYQFSS
EGAQSSFEDSEEDFDSRFDTDDELSYRRDSVYSCVSLPYFHSFLYMKGGLINTWKRRWCV
LKDETFLWFRSKQEALKQGWLHKKGGGSSTLSRRNWKKRWFVLRQSRLMYFENDSEEKLK
GAMDVRTAKEIVDNTGKENGIDLIMSDRTYHLIAESPEDASQWFSVLSQVHASTEQEIQE
MHDEQANPQNAVGTLDVGLIDSVCAADNPDRPNSFVIITANRVLHCNADTPEEMHHWITL
LQRSKGDTRVEGQEFIVRGWLHKEVKNNPKMSSLKLKKRWFVLTHNSLDYYKSSEKNALK
LGTLVLNSLCSVVPPDEKIFKETGYWNVTVYGRKHCYRLHTKLLNEATRWSSAIQNVIDT
KAPIDTPTQQLIQDIKENCLNAEVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLK
DKGYTTLQDEAIKIFNSLQQLESMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVP
NPGSVGNLYSWQILTCMSCTFLPSRGILKYLKFHLKRVRDQFPGTEMEKYALFTYESLKK
TKCREFVPSRDEIEALIGRQEVTSTVYCHGGGSCKIAINSHTTAGEVVEKLIRGLAMEDS
RNMFALFEYNGTTDKAIESRTIVADVLAKFEKLAATAEVGEMHWKFYFKLYCFLDTENVP
KDSVEFAFMFEQAHEAVIKGHYPAPEETLQVLAALRLQYLQGDYTVHTTIPELEEVYPLQ
KLKSRITQSTKTFTASEKTEKKRASFLEGTLRRSFRSGSVSKQKVEEDQMLDMWVKEEIS
ASMTSIMDKWKKLQRMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSAD
AVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDIAKLMKAYIS
MIVKKRYSTSRSVSSHGSQG
Download sequence
Identical sequences H0ZAH0
ENSTGUP00000007574 ENSTGUP00000007574 59729.ENSTGUP00000007574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]