SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007682 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007682
Domain Number 1 Region: 56-123
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000111
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 112-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000165
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 3 Region: 213-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000105
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000007682
Domain Number - Region: 170-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00206
Family EGF-type module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007682   Gene: ENSTGUG00000007459   Transcript: ENSTGUT00000007763
Sequence length 415
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:28983119:28986410:1 gene:ENSTGUG00000007459 transcript:ENSTGUT00000007763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSCLSRQQLLAAIRQMQQLLKGQETRFSEGLRTVRSRLSTIHASLAKATPEPPVAACPAL
QAPVDGRKFGTKYLVDHEIHFACDPGFQLLGSSTRICQANGSWTGQEAHCAEISECSSSP
CQNGGTCLEGLNHFKCLCPPQWTGITCQYQVQTVPPTWSVTDDPAFSRQPRCAQIAQTQQ
CSCDPGFHMSGTASNGICRDLNECEVYQQQGGPRLCAHACVNIPGSFHCSCPAGYILLGD
GKSCEDIDECSLSQDNCTSGSTCINTGGGFQCVTPQCPSAAGNISYVKTSPFQCERNPCP
MESRSCHQAPKTISFHYLPLPSKLQTPAPLFRMATAVAPGRPGPDSLRFGIAGGNNRGHF
VVQRSDRHTGELLLVQSLQGPRTIHVDVDMTEYLDRVFQAKHLSKITLFVSAYEF
Download sequence
Identical sequences H0ZAS7
ENSTGUP00000007682 59729.ENSTGUP00000007682 ENSTGUP00000007682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]