SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007726 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007726
Domain Number 1 Region: 228-420
Classification Level Classification E-value
Superfamily vWA-like 1.11e-55
Family Integrin A (or I) domain 0.00031
Further Details:      
 
Domain Number 2 Region: 928-1132
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.87e-26
Family Laminin G-like module 0.058
Further Details:      
 
Domain Number 3 Region: 717-892
Classification Level Classification E-value
Superfamily Fibronectin type III 2.43e-25
Family Fibronectin type III 0.00073
Further Details:      
 
Domain Number 4 Region: 536-705
Classification Level Classification E-value
Superfamily Fibronectin type III 3.73e-19
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 5 Region: 446-532
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000013
Family Fibronectin type III 0.00093
Further Details:      
 
Domain Number 6 Region: 28-100
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000513
Family Fibronectin type III 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007726   Gene: ENSTGUG00000007458   Transcript: ENSTGUT00000007807
Sequence length 1473
Comment pep:novel chromosome:taeGut3.2.4:20:9591956:9649314:-1 gene:ENSTGUG00000007458 transcript:ENSTGUT00000007807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMHTWFFLACLPVVSHVWGRVGQGSGRLKLTVLSEDRLQMKWKETEGNISGYKVRVKPM
AGDSEQEVMLKTKTPKATVGGLSPTKEYTLQVYVLNGSQEALFAKRKFVIEELRNASQTR
NNRRNAGAASGKNLTSSAXXXXXXXXXXXXXPPPLNTALSHSAKDRAEKKRQKGIQPKSP
GETTRNQPSVEASVTETASTTPKSSPHTPANTEQESPGKEKPPKDPLRRGSQFQCDTPAM
IDLVLLVDGSWSIGRNNFKLIKEFLSNLISPFSIAEDKIRVGLSQYSSDPRTEWELSAYS
TREQVLEAVRNLRYKGGNTFTGLALTHVLEQNLKPDAGARLEAEKLVILLTDGKSQDDAN
LAAQTLKNLGIEIFAIGVKNADEAELRQVASEPLELSVYNVLDFPLLSSLVGKLTRVLCA
RIKERSHKDTTGSAVKDTPVNTGPQLSPTDLKISAVTSKSMHLAWSPPLRPPKKYRVVYY
PSKGGTPKEVVLEGAVSSLQLSNLTSHTEYLVSVIPVYDSAAGDGLRGVTSTLPLSPPRS
LRVSELSHNSLRLSWKAAQGATHYLVLCSAAPDGAEDYTTEVKVTQPEVLLEGLSPSTGY
SVAVYAMYGEDASDPASIQETTLALSPPRYLSFSELSHASVRVSWEPAAPAVRAHHLTYV
SSRGGNAGQVEVPGTATSTVLRPLSSLTQYFISVRSTYDEGDSFPITGNVTTLKVPPPRA
LKVTELSGNSLRLQWEAVAASDVVVYQIKWSTASGEKPQELSLAGNVATAILPGLQKNTD
YKISIWAYYKDGARSDTVSVHHRTNSRSPPTNLFIDSETPSSLQVHWTPPDGRVQHYKIT
YSPVSDAAAQQTIMAPGKSSSVTLQSLLPDRAYRVTISAIHYTGESQSSSTTGRTAPVLS
KFPSIRGFIPPKAEACPTITSREGSIRGFDMMEVFGLVEKEYSSIKGVAMEPFVFSGSRT
FTLFRDIQLTQRTSDVHLFAIPPEHTIVILLRLLPDTPKEPFAVWQVTDEDFQPLLGVNL
DPSKKSLTYFNHDYKADLQEVSFDEQEVKKIFYGSFHKVHVAVSHSKVKLYVDCKKTAEK
PINTLGSVSSAGFIMLGKVTRTRGPRSGSVPFQLQSLQILCSSVGAEQDRCCDLPALRDE
DTCPTLAPACSCTSGRPGLPGPPGPPGSPGRRGPQGEQGEPGPKGEPGPPGQVGPAGPSG
QQGSPGSQGITVQGPVGPPGIKGEKGDTGIPGMQGMPGVQGAPGRDGLQGAKGVRGLEGT
AGPPGPPGPRGFQGATGTRGSSGEKGPPGDVGPTGLPGPKGERGEKGEPQSLATIYQLVS
QACERMIQTHVLKFDSFIHEHARKPVPIWEERLKPGEPGPPGPPGPPGNSGERGENGTPG
QPGKDGYPGERGAPGPKGEKGMSGASEEGSQGPRGRTGPPGEVVQGKPGPKGFPGNAGPP
GIPGVRGQPGQPGQPGGCDISGCYEADRRDFVP
Download sequence
Identical sequences H0ZAW9
59729.ENSTGUP00000007726 ENSTGUP00000007726 ENSTGUP00000007726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]