SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007738 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007738
Domain Number 1 Region: 15-157
Classification Level Classification E-value
Superfamily C-type lectin-like 1.05e-19
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 2 Region: 224-336
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000157
Family Growth factor receptor domain 0.0069
Further Details:      
 
Domain Number 3 Region: 352-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 4 Region: 379-422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000273
Family EGF-type module 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007738   Gene: ENSTGUG00000007522   Transcript: ENSTGUT00000007819
Sequence length 422
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:29058151:29059416:1 gene:ENSTGUG00000007522 transcript:ENSTGUT00000007819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLLPLLAWSCGGEDVEVLCADSACYTLHRDESSWKSAQERCKDNGGNLAPVGSAGEAAR
LRELLARADWAGPAWLGLALPRGHCVRPQEPLRGFSWVAGGAPGNFSEWASEPAVTCVSA
RCAALRPPGPHGPGGWADRACRSTLPAFLCKFSFQGMCGLLPLAGRGTVTYTAPFGVRSA
RLAAAPFGTLAEVECDSGRASAFAVCKGPLDGGGFAWHPPGPLCPVNCGRHNGGCQQLCL
DVPGESPRCACRPGYVLAADMASCVPEDSCHPNPCQGSCRALPGGFECGCEPGYVLAADG
RGCSDVDECESGPCQHQCHNFPGGFQCHCRPGYSSAGPAGHHCHDVDECAQPDACPQLCI
NIPGSFRCTCRPGFQRQPGGESCLDVDECLRDPCPGACRNFPGGYECLCPPGFLRDDDGH
GC
Download sequence
Identical sequences H0ZAY1
ENSTGUP00000007738 59729.ENSTGUP00000007738 ENSTGUP00000007738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]