SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007828 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007828
Domain Number 1 Region: 4-120
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.39e-42
Family GABARAP-like 0.00000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007828   Gene: ENSTGUG00000007601   Transcript: ENSTGUT00000007913
Sequence length 125
Comment pep:known chromosome:taeGut3.2.4:11:10567035:10573946:1 gene:ENSTGUG00000007601 transcript:ENSTGUT00000007913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSEKSFKQRRTFEQRVEDVRLIRDQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNM
SELIKIIRRRLQLNSNQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFG
APASA
Download sequence
Identical sequences B5G485
NP_001232222.1.42559 XP_005528210.1.90289 XP_012425945.1.42559 XP_015495500.1.82291 XP_021393621.1.53032 ENSTGUP00000007828 59729.ENSTGUP00000007828 ENSTGUP00000007828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]