SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007839 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007839
Domain Number 1 Region: 44-791
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.22e-275
Family Motor proteins 0.000000000134
Further Details:      
 
Domain Number 2 Region: 1986-2102
Classification Level Classification E-value
Superfamily Second domain of FERM 1.09e-22
Family Second domain of FERM 0.0022
Further Details:      
 
Domain Number 3 Region: 2103-2193
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-19
Family Third domain of FERM 0.014
Further Details:      
 
Domain Number 4 Region: 1889-1994
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000723
Family Ubiquitin-related 0.098
Further Details:      
 
Domain Number 5 Region: 798-865
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000077
Family Motor proteins 0.041
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000007839
Domain Number - Region: 1613-1655
Classification Level Classification E-value
Superfamily SH3-domain 0.00016
Family SH3-domain 0.0039
Further Details:      
 
Domain Number - Region: 1379-1435
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00262
Family Second domain of FERM 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007839   Gene: ENSTGUG00000007532   Transcript: ENSTGUT00000007924
Sequence length 2202
Comment pep:known_by_projection chromosome:taeGut3.2.4:9:7274126:7320231:1 gene:ENSTGUG00000007532 transcript:ENSTGUT00000007924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVLRKGDHVWLDTQPKSEFNVPIGAVVKESHSGRILLEDDEGKEHWITARNMHMVHLMH
PSSVQGVEDMIRLGDLHEAGMVHNLLIRHQEHKIYTYTGSILVAVNPYQLLPLYTVDQIR
LYCNKRIGELPPHVFAIADNCYFNMKRNKRDQCCVISGESGAGKTESTKLILQFLAAVSG
QHSWIEQQILEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNQNGVIEGARIEQFLLEKS
RVCRQAPEERNYHIFYCMLMGMNTEQKKMLNLGTASEYTYLTMGNCMSCDSRNDAKDYAH
IRSAMKILMFSDSEHWDISKLLAAILHLGNVEFQAAVYDNLDCSDVIDSPHFSIATKLLE
VDSSELQNSLTNLSIIVRGESVSRPLNVVQAANGRDAFVKGIYGRIFLWIVNKINSAIFN
PASQKPKDRHQSIGLLDIFGFENFSNNSFEQLCINIANEHLQQFFVHHVFKLEQEEYLAE
HIAWNNIDFTDNHQALEVIALKPMNIISLIDEESRFPKGTDATMLVKINSLHGKSKVYIP
PKSVHDTKFGINHFAGVVFYESKDFLEKNRDTLSANVMQVVHSSKNKFLREIFQVQMANG
LDTTKRLSTLGGQFKQSLEKLMKILEQCQPYFIRCIKPNDYKKPLLFDRELCIKQLRYSG
MMETIQIRKAGYPVRYSFEEFFERYRFLLPWAIDPCILKNDTRQSCISISEAVLGKDESW
QVGRTKIFLKDHHDTVLELQRQNILTDKVLLIQKVMRGLKDRSQFLKQRRSAVAIQSAWR
GYCCRKEFRTVLLGFGRLQALYRSRQLAQQYETMRARIVAFQALCRGFLLRQRLAEQKKA
ACVIQAYARGMLARQTYRRIKREYKSRVLSRLIFQSYKGKLTSTVGWHSGSARKESQHSV
RLFLCLKEHLPTQGREEAEARPRRNVLANKPANHDVISDQEMVDKIFGFLPSVIGGQEGQ
APLGFEDLETKPNKLEEVDLDMVPMSVELEEEALGLEDYTFPKFAATYFQGSSTHTHIRR
QLRHPLLYHEDKDNVLASLAVWVIILRFMGDLPEPAMFAKSATTKSSSVMTQIYDTLGRK
NQERKKTKISSLEHLSKEGRRDNKISKGISSLKLKRSSKLTGKVTEQLRSGEEAFQEDIS
ISQRPMSNLEKVHFIIGNAILRPAIRDEIYCQICKQLTENSNRSSYARGWILLSLCLGCF
PPSDTFVKYLLNFIHHGPTGYAPYCAERLRRTYSNGARTEPPSWLELQGIEDQPPRSGHT
SIHSGTTGQKQPPEESSYYHFWKELSNAYAFKMKGRREYDGAILSSTSFKCHPSHLSTDA
HKAAPKSHQDKAHEKSINWHCYCCSRDVIYIYESPCFDALKKLVIQTKIEKTHFLNGPKE
EDLVEIGAKYCYIQFGDTIHNELVQKVLHDCIPVKQLKSKPLEKWVSLVTYAHAKAPYTQ
DHLSSQTVKEQLVDFARFQWPLLFSRFFEVTKFSGPSLPKNHFIIAINWKGICFLDESEK
RLLELSFPEITGIHTNSWCKVILFRSYKKAPCEDCQNGSVRFSDALVTNCSIIHRAVKSF
GQSCTLITLRAEEFVLTSVNSVVIAELVVMFLEGLKKRSQFAVAMHEKKSQVGKDPGILS
FKKGDLLIFTEGKRLDSDSGWICAQNERTGKTGNVFLEDIYIIPSLTKPSSQVLSLLMMS
PDQRRTASQNSFMEEPDEEDIKVKPYTLEEFSYEHFRTPEKESISKAVLQKSRGHSQLWA
HSKEPLKQPLLKRACTDPDLRDLASHSPIMKFMGDYPSKQAHSSVEVTDQIFVPAIQEEV
LRDEIYCQIMKQLTENRNRYSETKGWQLLWLCTGLFPPSKSLLKHAQKFIETRQKETLAP
GCRRRIQTVMRSGCRKWAPHPVEVEAILQNNTKISHKICFPNETELTFDVGTNTKIQTLC
QNIASKLELHSWEGFSLFVKIADKVISQNEADYFFDSLRQVTDWNRRNKPGKDGAALSVA
YEVYFMRKLWLNVTPGKDLKADTIFHYHQELPKYLRGYHKCSKEEAVQLAGLICKARFNN
DRTQLAAIPKILKELVPDNLLRAVAPDEWKKSIIAAYSKHEGKTVDEAKIAFLKMIHRWP
TFGSAFFEVKQASEPNFPEIVLIAINKQGVSLIHQKTKDILVVYPFNKISNWSSGSTYFH
MTIGNLVRGNRLLCETSLGYKMDDLLTSYVRLLMNAVNKQKN
Download sequence
Identical sequences H0ZB81
ENSTGUP00000007839 59729.ENSTGUP00000007839 ENSTGUP00000007839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]