SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007845 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000007845
Domain Number - Region: 807-853
Classification Level Classification E-value
Superfamily HCP-like 0.0144
Family HCP-like 0.013
Further Details:      
 
Domain Number - Region: 113-247
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0455
Family YVTN repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007845   Gene: ENSTGUG00000007581   Transcript: ENSTGUT00000007930
Sequence length 1352
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:8011766:8037948:1 gene:ENSTGUG00000007581 transcript:ENSTGUT00000007930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYGDSAGGFCYQESAQLGAATRNRWVRWSTSGDTVELVEESLDVNLLNNAVRLRIQGCPF
LPGGIHLCEVQSHLVVLLLTAQTVHRLLLPHPARLYRSVRKVESQVQSVFTDISKIHIRD
PSNYYVIPSVPGLAPNSVASAAWLSSEGEALFALPSASGGIFVLKLPPPDAPGSVSVVEL
KQSSVVQRFLTGWMPTAIRGDGGPSDVPVSLSVHCLDHDAFLFALCQDHKLRMWSYKDQM
CLMVADLLEFMPVSRDLRLAAGTGHRLRLAFSQSLGLYLGVYMHAPKRGQFCVFQLVSTE
SNRYSLDHISSLFSSQETLVDFALTSAEIWALWHNEENQTVVKYINFEQNVAGQWNQVFV
QPLPEEEVTVRQDQDPREIYLEYLFMPGRFTNAAIQKALQIFSQGTERHMDLTWDELRKE
VTLAVENEFQGSVTEYECSPEEFWQLQVEFWSKFYACCLQYQEALSRPLALHLNPYTSMV
CLLKKGSMSFLVPCSLVDHLYLLSNEHFLTEDDAAIFEDLEMSRDVVCLVQCLRLIGESI
SMEMAFIMEMACSRLQPPEKAAEQILENLIANDTENVMEDIHSKLQEIRNPIHAIGLLIR
EMDYETDADMERAPHLALRMSLSQLFGSSTAAHVVCGGVAKICTVRFLLCRDLLILQQLL
LRLGDPMVLGGGQLFQSQQDLLHRTSPLLLSYFLIRWASQCLASDVPVDTLESNLQHLSV
LELADTTALTPHKLVSGPQTIVELFFQEVARKHIISRLFLQPNTSLAETSLNWPHLITSI
VADFLPLLWPSNPSFLFPECLMGSCQYTQLQEYIRLLQPWCHVNIGSCCFMMGRCYLVMG
EGHKALDCFCQAASEVGREEFLDRLIQPEEGEVVSTPRLQYYNKVLRLLEMLGLPELVIE
LATLAIMESADDWRSQATLRTCIFKHHLDLGHNSEAYVALTQNPDPSRQLDCLRQLVVVL
CERSQLQDLVEFPYVNLHNEVVGIIESHARAVDLMTHNYYELLYAFHVYRHNYRKAGTVM
FEYGMRLGREVRTLRGLQKQGNCFLAAINCLRLIRPEYAWIVQPASGAVYERPGASPKRS
HDGECMAVPTTHQIEILELEDLERECLLARIRLTLVEHDVSAAAVAGNSTPEETVSLLVR
AGLFDSAITLCQTFKLPLTPIFEGLTFKCIKLQLGGEAAQAKAWDWLAANQLSALVTTKE
SSATDEAWRLLSSYLERYPSQNSLYHRCVINKLLAHGIPLPNWLINSYKEVDAAELLRLY
LSYDLLEEAVDLVLEYVDAVLGKGHQYGIEVPLSPVSPTMWLPYTAIDQLLQALRESSAS
ENSVVLYEKLNDKMEDYQQKVSVATTERLYCR
Download sequence
Identical sequences H0ZB87
ENSTGUP00000007845 59729.ENSTGUP00000007845 ENSTGUP00000007845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]