SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007869 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007869
Domain Number 1 Region: 32-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-68
Family SPRY domain 0.00000000678
Further Details:      
 
Domain Number 2 Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000523
Family SOCS box-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007869   Gene: ENSTGUG00000007647   Transcript: ENSTGUT00000007954
Sequence length 273
Comment pep:known_by_projection chromosome:taeGut3.2.4:9:7410458:7467925:-1 gene:ENSTGUG00000007647 transcript:ENSTGUT00000007954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKISGSIKSVDVREPPYRPVKRELRGPDFCKPARLDMLLDMPPAKLEVQYKHAWNNED
RSLNIFVKEDDKLTFHRHPVAQSTDCIRGKVGYTRGLHVWQIHWPTRQRGTHAVVGVSTA
DAPLHSVGYTSLVGSNNESWGWDLGRNKLYHNCKNQPGVTYPVFLEPDESFVLPDSLLVV
LDMDEGTLSFMVDGQYLGVAFRGLKGKKLYPIVSAVWGHCEITMRYINGLDPEPLPLMDL
CRRSIRFALGRDRLHDIEILPLPLSLKNYLQYQ
Download sequence
Identical sequences H0ZBB1
ENSTGUP00000007869 ENSTGUP00000007869 59729.ENSTGUP00000007869 XP_005428707.1.5688 XP_005489385.1.73095 XP_012430975.1.42559 XP_014124135.1.73095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]