SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007890 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007890
Domain Number 1 Region: 554-732
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-41
Family SPRY domain 0.00062
Further Details:      
 
Domain Number 2 Region: 371-550
Classification Level Classification E-value
Superfamily Fibronectin type III 3.08e-25
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 3 Region: 159-209
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000403
Family B-box zinc-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007890   Gene: ENSTGUG00000007666   Transcript: ENSTGUT00000007975
Sequence length 736
Comment pep:novel chromosome:taeGut3.2.4:10:10868313:10880774:-1 gene:ENSTGUG00000007666 transcript:ENSTGUT00000007975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FYHMDLYGSKERFDIFPEELSGQGDRSLGDTRRESALSSEKVQCPQEVGYDLEKEVAELA
KMYGLDEDREKELELLGGHLEKVESRWPPARTGKAVKDPSQSTKQQGFPDEASQGENQSK
ARADDEAESSIWSRGGLSSGGMSDEWNSQAVSEEEEEEEEAADVFCSTCKIPIRAFDKLF
GEHKDHEVAQLPSAVESEKEEIHKNMCKLEEQIAQMENVASHLEEIFITVEENFGRQEQN
FEVHYNDAVQVLAQKYEEQLEALGEEKRQKLEALYEQLVSCGKHLDTCKELTDETQELFL
ENDKAEFMKVKSFNNYRLEEFLKKEVDLELSTLPDFEERVIDVSEVEQLMNSINAIPAPC
APVINPQAPNAATGTSLRVCWGLFSDDTVECYQLCYQPVSNERHSDGPAEHTLKVKETYC
TITDLLPNTQYEFWVSALNASGISPPSERAVYVTAPSPPTIKNKKIRSCENAALVCWESR
DINPVDSYTVELSKLTDEENDDIITESIVGIPNCEVLIHLQPTQKYQICVRAQNLGGCSE
RSEPVLIHTTGTCFYLNEDTAHPLLAILDDGFTISCDELENPECDLPVYDNSFTRCIAIL
GSLIPFPGKHYWEVEVEEDTEYRIGVAFENTPRHGHLGANNSSWCMRHIITPSRHKYEFL
HSGMTPDIRITVPPRRIGILLDYENCRLAFFNADIAQHLHTFNSHFQHYVHPCFALETPG
ILRIHTGITTPPWTVL
Download sequence
Identical sequences H0ZBD2
ENSTGUP00000007890 ENSTGUP00000007890 59729.ENSTGUP00000007890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]