SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007934 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007934
Domain Number 1 Region: 527-768
Classification Level Classification E-value
Superfamily VPS9 domain 1.96e-54
Family VPS9 domain 0.0012
Further Details:      
 
Domain Number 2 Region: 90-195
Classification Level Classification E-value
Superfamily SH2 domain 6.6e-16
Family SH2 domain 0.003
Further Details:      
 
Domain Number 3 Region: 785-861
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000062
Family Ras-binding domain, RBD 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007934   Gene: ENSTGUG00000007689   Transcript: ENSTGUT00000008019
Sequence length 882
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:29762004:29802131:1 gene:ENSTGUG00000007689 transcript:ENSTGUT00000008019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLTMRTCCVDKRGSFFKLIDTIASEIGELKQEMVQTDLTVEDECADWRSLIVDMDNVS
PEKNDVKCCPRDSGYDSLSNKLSILDKLLHTHPVWLQLGLNDAEAMEILQTQPPGIFLVR
KSATLQKKVISLRLSSDSGSCLKEFAIKESTYTFSLEGSGISFADLFRLIAFYCISRDVL
PFTLKLPHAIAAAKTEGELEEVAQLGLNFWSSLASSKPPDPSLPCRPVPLDSAHKDSRQL
CLINGVHSIQTRTPSELECSQTNGALCFINPLFLKVHSQDVSGSLKRQTLRTPDVNGRAR
PCSPPPRPPPPAINSTLMSPQISRTIKQTSMPETVSHKKERGLDLLQNKPTPIPPPRLKK
QAVCPEADSASRSVATVRPDSACVPEAAAVPHETLPEPAPAAPKKTPAAISESHIPWNRG
QQRLSDMSISTSSSDSLDFDRSMPLFGYEGDTNSSLEDFEGESDQESMAPPLKPKKKRSS
SFVLPKIVKSQLRKVSGVFSSFMTPEKRMIKKIAEMSRDKRTYFGCLVQDYVSFLQENKE
CHVSSTDMLQTIRQFMTQVKNYLSQSSELDPPIESLIPEDQIDVVLEKAMHKCILKPLKG
HIEAMLKEFHTTDGSWKQLKENLQLVRQRNPQELGVFVPTPDFVDLEKIKVKFMTMRKMY
SPEKKVMLLLRVCKLIYTVMENNSGRLYGADDFLPVLTYVLAQCDMLELDTEIEYMMELL
DPSLLHGEGGYYLTSAYGALSLIKNFQEEQAAQLLSSEARDTLRQWHKRRTTNRTIPSVD
DFQNYLRVAFQEVTSGCTGKTLLVRPYITTEDVCQLCAEKFKVANPEEYRLFLFVDDTWQ
QLTEDTYPQKIKAELHSRPQPQVFHFVYKRVNSDPYGAILQN
Download sequence
Identical sequences H0ZBH6
ENSTGUP00000007934 ENSTGUP00000007934 59729.ENSTGUP00000007934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]