SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007941 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007941
Domain Number 1 Region: 53-156
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 3.16e-28
Family Interleukin 17F, IL-17F 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007941   Gene: ENSTGUG00000007718   Transcript: ENSTGUT00000008026
Sequence length 159
Comment pep:known_by_projection chromosome:taeGut3.2.4:11:11197729:11198288:1 gene:ENSTGUG00000007718 transcript:ENSTGUT00000008026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRCFSGAELEDEAPAHLLGRSLRWDRHVPVQLVPQLERLESTGTRRPRRQRPPGCPELSV
RTGLRGEPHERSISPWRYRIDEDENRYPRKLAFAECLCGGCVDVKTGRETTSLNSVAIHQ
TMLVLRRKPCPAGPGLVALEVDYIRVPVGCTCVLPRTAR
Download sequence
Identical sequences H0ZBI3
59729.ENSTGUP00000007941 ENSTGUP00000007941 ENSTGUP00000007941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]