SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007943 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007943
Domain Number 1 Region: 102-192,228-481,580-639
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.22e-31
Family LacY-like proton/sugar symporter 0.087
Further Details:      
 
Domain Number 2 Region: 492-550
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000208
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007943   Gene: ENSTGUG00000007700   Transcript: ENSTGUT00000008028
Sequence length 722
Comment pep:known_by_projection chromosome:taeGut3.2.4:20:10403532:10418764:-1 gene:ENSTGUG00000007700 transcript:ENSTGUT00000008028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENGFCFTQPLDFSCPCPHPSEAGRALGAASGGDGCSTPLSNGITSSGAPSPSGSCAQPLC
TAQEETPLEEGIKYVSADGEELACGWGGFTPGCLQLCNTSKGVLFFLCVASFLQGMTVNG
FINTVITSIERRFDLRSYQSGLIASSYDIAACVCLTFVSYFGGNGHKPRWLGWGVLVMGL
GSLLFALPHFTTGRYEARSAAQLGVCGGNQSLPCSQAASSLSGYRFVFMLGQFLHGMGAT
PLYTLGVTYLDENVKTNYSPVYIAVFYTAAILGPAAGYLVGGMFLNIYTEIGRETDMAPE
NTLWVGAWWIGFLGAGAASLLISIPILGYPQRLPGSQRYIVMRVSEAHQLKDGSHKKASD
PDFGKTVKDLPRSVLLLLKNPTFIFLCLAGATEATLIAGMSTFGPKFLESQFSLSASEAA
TFFGYLVVPAGGGGTFLGGFLVNKFKLRCSGIIKLCLFCTVSSLLAIFIFFIHCPNMPMA
GVTQMYDGSALPGGHLNLTAACNAQCGCLQDTYSPVCGTDGIMYYSPCHAGCRSVSVNLR
NGKKVYQECSCVDKALLPGSGKAEAGKCTSSCAKKPLLLCFMFVVILFTFLSSIPALTAT
LRCVSDRQRSFALGIQWIVVRTLGGIPGPIAFGSMVDKSCLLWQDQCGEQGSCYVYQNSA
MSRYTLVAGLAYKVLGTTFFIVACLLYKPPPAESAPGSLDASENGTSDLQEHKPSLPAEE
DI
Download sequence
Identical sequences H0ZBI5
ENSTGUP00000007943 59729.ENSTGUP00000007943 ENSTGUP00000007943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]