SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007980 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007980
Domain Number 1 Region: 938-1045
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-24
Family PDZ domain 0.0000808
Further Details:      
 
Domain Number 2 Region: 55-158
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.97e-22
Family Ras-binding domain, RBD 0.0064
Further Details:      
 
Domain Number 3 Region: 243-348
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000000000127
Family FHA domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007980   Gene: ENSTGUG00000007743   Transcript: ENSTGUT00000008065
Sequence length 1053
Comment pep:known_by_projection chromosome:taeGut3.2.4:14:11573112:11591093:1 gene:ENSTGUG00000007743 transcript:ENSTGUT00000008065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYGPSSSMAPPSKNRLKRQSRLFSQVLYRTLSYKDRSSASPAAEDDPAELSTQLSAPGI
LKIFGGNICAGTNYKSVLVTGSSGARELVKEALERYGLSQLSAGQYALCDVIGRFQGPEK
QWHTEGLRVLADHEKPLLIQDLWKPREGFSRRLELRRRVEVEEMAARDVDTTTAGQSWVH
DPQRSTLGGPPGPPQHSSKTEATPAVRLSALQSAQPIAVLPDAGKTPTNCGGGSMRYSLY
QSPHLLLLQGYSQQHDSLVYLLNREQHTVGQRTQASKPSISLSAPDILPLHCTIRKLRPS
RHRSEEKLVLEPIAGAGISVNFAEVARTVVLRHGDLLSLGLYYLLLYKDPMKAQPLPAQT
LLRLRALHPEGPRVCGACGSLLKEKDKKRGPSPRTPRRKLQLEFEPAAEDVLLRRIMTLI
EPGGDDHKLTPAFLLCLCIQHSATNFEPGDFGQLLLKAARMIQRTVWERTRELAEKQSQH
QDPATLSRFTITDLLPDLQHIIFWMANAIEILYFVQQKSPTYIQSMEEELDIKGSKESLF
SSTITASEEAMTVLEEVIMYTFQQCVYYISKCLYVSLPALLECNPFQSEGRESWRGTPPL
PEELRRVVLIYQAVLDLLQQYEVHPEITSQMFAYLFFFSNTLLFNQLLEKGSSLGCYHWS
QGVKLRASVRLLLEWLHGAGFEQLAQQFFAKLASVANLLAMPGSQLVQMTWPSLRAEFPA
LSPAQLHRVLGQCQAVMDVGCISACSPPEPVLTPSLCFSDEVLESFDNHPPIILPSGGFK
VDLEVETLDDNIYRHLLYIRHFLWSLQSRSPHTSEGLGSAPPKCPHGELLEGLGGEMSLG
SAPFLPVSPLPRRIIAPWGAVPSQRGPPSPAWPPLGRSPVPKGGTVPPDPSCLLTPPTTP
LNFDCGSPESPQGTGKGPQDARRNGIKGSTPEGCSPTPYDYPTPESSSRSSATDDFCYVF
VVELERGPIGLGMGLIDGVHTPLCSPGIYIRTLIEDSPAAADGRLSVGDRILAVNGTSLI
GADYQSAVDLIRSGGKKLRFLVAKSDIEIAKKI
Download sequence
Identical sequences H0ZBM2
ENSTGUP00000007980 59729.ENSTGUP00000007980 ENSTGUP00000007980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]