SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007981 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007981
Domain Number 1 Region: 589-888
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.65e-83
Family Protein kinases, catalytic subunit 0.000000000528
Further Details:      
 
Domain Number 2 Region: 2-173
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.72e-74
Family Ephrin receptor ligand binding domain 0.000000951
Further Details:      
 
Domain Number 3 Region: 298-502
Classification Level Classification E-value
Superfamily Fibronectin type III 3.22e-41
Family Fibronectin type III 0.00015
Further Details:      
 
Domain Number 4 Region: 886-958
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.68e-21
Family SAM (sterile alpha motif) domain 0.000061
Further Details:      
 
Domain Number 5 Region: 229-300,336-359
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000597
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007981   Gene: ENSTGUG00000007665   Transcript: ENSTGUT00000008066
Sequence length 962
Comment pep:known_by_projection chromosome:taeGut3.2.4:9:8512999:8616591:-1 gene:ENSTGUG00000007665 transcript:ENSTGUT00000008066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWIP
REGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESNNDKERFIRESQFAKIDTIAA
DESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRN
LAQFPDTITGADTSSLVEVRGSCVNNSEEKDVPKMYCGADGEWLVPIGNCLCNAGYEERN
GECQACKIGYYKALSTDAACAKCPPHSYSIWEGSTSCTCDRGFFRAENDAASMPCTRPPS
APQHLISNVNETSVNLEWSPPQNKGGREDISYNVVCKRCGAGEPSRCRSCGSGVHFSPQQ
NGLKSTKVSITDLLAHTNYTFEVWAVNGVSKQNPSQDQAVSVTVTTNQAAPSPIALIQAK
EITRHSVALAWLEPDRPNGVILEYEVKYYEKDQNERSYRIVKTASRNTDIKGLNPLTSYV
FHVRARTAAGYGDFSGPFEFTTNTVQTGLVFPSPIIGDGTNPTVLLVSVAGSVVLVVILI
AAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPFTYEDPNQAVREFAKEIDASCIKIE
KVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIH
LEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVH
RDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSA
SDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKE
RSDRPKFGQIVNMLDKLIRNPNSLKRTGSESSRPSTALLDPSSPEFSAVVSVSDWLQAMK
MERYKDNFTAAGYTTLEAVVHMNQEDLARIGITALAHQNKILSSVQAMRTQMQQMHGRMV
PV
Download sequence
Identical sequences H0ZBM3
ENSTGUP00000007981 ENSTGUP00000007981 59729.ENSTGUP00000007981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]