SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007989 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007989
Domain Number 1 Region: 36-193
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.2e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007989   Gene: ENSTGUG00000007765   Transcript: ENSTGUT00000008074
Sequence length 198
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:15288297:15291738:1 gene:ENSTGUG00000007765 transcript:ENSTGUT00000008074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DERLELWHSKACKCDCQGGPNSVWSSGTNGLECMPECPYHKPLGFESGAVTPDQISCSNP
EQYTGWYSSWTANKARLNGQGFGCAWLSKYQDTAQWLQIDLKEVKVISGILTQGRCDADE
WMTKYSVQYRTDENLNWVYYKDQTGNNRVFYGNSDRTSSVQNLLRPPIVARYIRLIPLGW
HVRIAIRMELLECLGKCG
Download sequence
Identical sequences H0ZBN1
ENSTGUP00000007989 ENSTGUP00000007989 59729.ENSTGUP00000007989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]