SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008110 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008110
Domain Number 1 Region: 738-904
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-46
Family MAM domain 0.0002
Further Details:      
 
Domain Number 2 Region: 432-533
Classification Level Classification E-value
Superfamily Immunoglobulin 1.66e-16
Family I set domains 0.057
Further Details:      
 
Domain Number 3 Region: 232-323
Classification Level Classification E-value
Superfamily Immunoglobulin 9.62e-16
Family I set domains 0.0058
Further Details:      
 
Domain Number 4 Region: 337-415
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000531
Family I set domains 0.034
Further Details:      
 
Domain Number 5 Region: 42-126
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000104
Family V set domains (antibody variable domain-like) 0.084
Further Details:      
 
Domain Number 6 Region: 528-619
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000188
Family I set domains 0.032
Further Details:      
 
Domain Number 7 Region: 121-212
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000028
Family I set domains 0.086
Further Details:      
 
Domain Number 8 Region: 189-234,620-726
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000235
Family Fibronectin type III 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008110   Gene: ENSTGUG00000007851   Transcript: ENSTGUT00000008195
Sequence length 943
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:30808359:30901749:1 gene:ENSTGUG00000007851 transcript:ENSTGUT00000008195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGLLPISIFTSSFLSTAPAQAQIIHAGQACVVKEDNISERVYTIREGDTLVLQCLVTGHP
RPQVRWTKTAGSASDKFQETSVLNETLRIEKIQRLQGGRYYCKAENGVGVPAIKSIRVDV
QYLDEPVLTVHQTISDVRGSFYQEKTVFLRCTVNSNPPARFIWKRGAETLSHSQDNGVDI
YEPLYTQGETKVLKLKNLRPQDYASYTCQVSVRNVCSIPDKSVTFQLTNTTAPPALKLSV
NETLVVNPGDNITMQCSLTGGDPQPEVAWSHSPGPMPPNSLVQGGNLTIWRIRVEDSGYY
NCTAINNVGNPAKKTVNLLVRSMKNATFQITPDVIKESETIQLGQDLKLSCHVDAVPQEK
VVYSWYKNGKPARFSDRLLITRNDPELPPVTCSLEIIDLRFSDYGTYLCVATFQGAPIPD
LSVEVNISSETVPPTISVPKGQSTITVREGSRAELQCEVRGKPKPPIIWSRVDKETPMPS
GTMTMETYDGKLHLENVSREMSGTYRCQTARYNGFNIRPREALVQLNVQFPPVVEPAFQD
VRQGTGHSVTLRCTMLKGSPMKVATSVWRFNGSLLAQPLAEQQDYSELKVDSVSRETSGS
YECSISNDVGVSTCLFQVSAKAYSPEFYYDTPNPTLSQKQSKNYSYVLQWTQKEPDAVDP
ILKYRLEVRQLSQRNTIQTFIPVKQMEKGLLLEHILPNLKVPQSYEVRLTPITSFGAGDM
SARVIRYMEPPSLPLPTDNTCRFEDEKICGFVQDKMDNFDWTRQNALTQNPKRTVNTGPP
TDISGTPEGYYMFIEASRPRVTGDKARLISPLYNITAKYYCVSFYYHMYGKHIGSLNLLV
RVRNKRAIDTQVWSLSGNRGNVWQQAHVPINPPGPFQIIFEGVRGTSYEGDIAIDDVTLK
KGDCPRKPIGPNKAVALPGSSVPALHSPWLCGPLTFFLYVLLR
Download sequence
Identical sequences H0ZC02
ENSTGUP00000008110 59729.ENSTGUP00000008110 ENSTGUP00000008110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]