SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008117 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008117
Domain Number 1 Region: 647-715
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 1.31e-27
Family AN1-like Zinc finger 0.0000303
Further Details:      
 
Domain Number 2 Region: 7-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.38e-27
Family Ubiquitin-related 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008117   Gene: ENSTGUG00000007872   Transcript: ENSTGUT00000008202
Sequence length 720
Comment pep:known_by_projection chromosome:taeGut3.2.4:6:16778001:16796161:-1 gene:ENSTGUG00000007872 transcript:ENSTGUT00000008202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANKKEPPFFNKDNMGPFHYKLPFYETMELFIETLTGTCFELRVSPFETVISVKAKIQRL
EGIPVSQQHLIWNNMELKDDYCLDDYNISEGCTLKLVLAMRGGPVNTRRVPVKDPIREMA
EYMDPARDKIWEKGPTNKQVTFLVYREGDRLNFFRVVDRGDGTLTPLSESGKVGFNLYII
LQKFLHNVFGGSVYNIYADDEDETEASPSGQQILENSITMNKMKLLKAKMENMNLSKKPK
KTVKVKPRPPMTPRPSSGSGAAARHRFLRVLPHIGQSCLPPPGNLHQSESPQNALSALAT
LATAGRTMPSTANHFLKEDDTWQSSSWSQPVNSIRLPPKISRVELENAMLPTNSILTPVS
SLPANSEKAPENATSASEEDAVLEEEHLPEPDTFAFLAEGSTAEQCSEIYDIGNVNPELE
LPDGDKDSEVVEQHRKPIGKVLSTAAMETGLLSTRELSPQKNLLLSPLRYSAQVARHSTL
KPQAQPRCFEAGNLRSTASPDVLRSVEVRSIADSSFSRTTRFCSVKVEPLGKRPDVISKA
EASDITDVASKASKEPASSVSNLGFLASLARSTNRESLQSSCGTDRFRTSGIALPTSLQH
FQEESFRKTSPNEAAEYILSAHGLGMNGSMAAVGKRVGEATHLPPVNGLIQAKKKISKHC
FLCGKKTGLATSYECRCGNNFCATHRYAETHTCTYDYKSAGRRYLQETNPIISAPKLPKI
Download sequence
Identical sequences H0ZC09
ENSTGUP00000008117 59729.ENSTGUP00000008117 ENSTGUP00000008117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]