SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008152 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008152
Domain Number 1 Region: 10-221
Classification Level Classification E-value
Superfamily L domain-like 3.51e-32
Family Ngr ectodomain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008152   Gene: ENSTGUG00000007920   Transcript: ENSTGUT00000008237
Sequence length 221
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:44666030:44669578:1 gene:ENSTGUG00000007920 transcript:ENSTGUT00000008237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SECRWDRQFLLNCSFTRISTIPEDLSQIAVTADLSYNNIKTFVCSDGRNEEWMLKHLNLS
NNLISELTLTTCTNLSNLETLNLSGNAIHTLTLEMLIPAQGSKKYGIVDRLLPALKVLSV
ERNNLNTVPRGLGLLQSLQTLHMSSNAIQQIDPKDFQNCLQLKDIDLRNNKITKIHPDAF
RDLNKLQVVDLRENALTIPLPQILVSLNFFQLEVYLSKNAW
Download sequence
Identical sequences H0ZC44
ENSTGUP00000008152 59729.ENSTGUP00000008152 ENSTGUP00000008152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]