SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008213 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008213
Domain Number 1 Region: 728-918,1233-1321,1503-1560
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.96e-104
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000931
Further Details:      
 
Domain Number 2 Region: 178-355
Classification Level Classification E-value
Superfamily EF-hand 9.69e-26
Family Calmodulin-like 0.0018
Further Details:      
 
Domain Number 3 Region: 370-424,518-585
Classification Level Classification E-value
Superfamily DUSP-like 8.63e-23
Family DUSP, domain in ubiquitin-specific proteases 0.0037
Further Details:      
 
Domain Number 4 Region: 19-164
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000669
Family Calmodulin-like 0.024
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000008213
Domain Number - Region: 645-704
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000437
Family Ubiquitin-related 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008213   Gene: ENSTGUG00000007936   Transcript: ENSTGUT00000008298
Sequence length 1598
Comment pep:novel chromosome:taeGut3.2.4:19:9706376:9765364:1 gene:ENSTGUG00000007936 transcript:ENSTGUT00000008298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAKESRIGFLGYDEALRRVTDIELKRLKDAFKRTCGLSYYMTQQCFIREVLGDGVPPKV
AEVIYCSFGGISKGLHFNNLIVGLVLLTRGREEEKTKYIFSLFSNESGSYVVREEMEKML
HVVDGKVPESLKKCFSEGEKVNYEKFRVWLLHNKDAFTFSRWLLSGGVYVTLTDDSDTPT
FYQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFAPLVSPPIHQSLSEGLFNAF
DENRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDVDRDGVLSRTELKDMVVALLEVW
KDNRTDKIPELDMGLSEIVEDILHVHDNTKLGHLTLEDYQIWSVKSALANEFLNLLFQVC
HIVLGLRPATPEEEGQIIRCWLERESRYGLQPGHNWFLIAMPWWHQWKEYVKYDANPVVI
EPSSVLSGGKNPLVAAAANTPEQGEDKMGGLNGFSAPEEKFSDNISTASEASESTSSNTL
YPGTPGSEVSFARQHNTSDNNNQCFLGSNGNTLLQLNPQKPGAIDNQPLVTQEPVKAASL
TMEGGRLKRSPQLVEGKDYVMVPEPVWRALYHWYGANLSLPRPVIKNSKTNVPELELFPR
YLLFLRQQPATRTQQSNVWVNMGNVPSPNAPLKRVLAYTGCFSRMQTIKEIHEYLSQRLR
IKEEDMRLWLYNSENYLTLLDDEDHRLEYLKIQDEQHLVIEVRNKDMSWPEEMSFIANSS
KIDRHKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTRYFISGRHLYELNRTNPIGMK
GHMAKCYGDLVQELWSGTQKNIAPLKLRWTIAKYAPRFNGFQQQDSQELLAFLLDGLHED
LNRVHDKPYVELKDSDGRPDWEVAAEAWENHLRRNRSIVVDLFHGQLKSQVKCKTCGHIS
VRFDPFNFLSLPLPMDSYMHLEITVIKLDGTTPVRYGLRLNMDEKYTGLKKQLSELCGLK
PEQILLAEVHSSNIKNFPQDNQKVRLSVSGFLCAFEIPIPGSPTSASSPVQTETSTGPSA
NGAPSILMNGDVAKPSLIPNGMPNTVVPCGTERSPPSWTLNGHVPSLCDSPCTGYIIAVH
RKMMRTELYFLSSQKNRPSLFGMPLIVPCTVHTRKRDLYDAVWIQVSRLASPLPPQEASN
HAQDCDDSMGYQYPFTLRVVQKDGNSCAWCPWYRFCRGCKIECTEDRACVGSAYIAVDWD
PTALHLRYQTSQERIVEEHESVEQSRRAQAEPINLDSCLRAFTSEEELGEDEMYYCSKCK
THCLATKKLDLWRLPPILIIHLKRFQFVNGRWIKSQKIVKFPRENFDPSAFLVQRDPSHF
QRKQLTLQVESLPEARPGQGDTRKADVQNTGTAGEGDTLNRSPSSLNTTVLNNVKASPSL
GRKSGTSCPSSKNSSPNSSPRTLGRGKGRLRLPQLGKNKLSSSKENLAANRENGAEHEQG
DALTKGQALGGSQSELYPGQDSEGALANGFLWEQSSLSNGQGENHSEDDTADDQRDDGWL
SPIYNLYAISCHSGIMGGGHYVTYAKNPNNKWYCYNDSSCKELHPDEIDTDSAYILFYEQ
QGVDYAQFLPKIDGKKMADTSSMDEDFESDYKKYCVLQ
Download sequence
Identical sequences H0ZCA4
ENSTGUP00000008213 ENSTGUP00000008213 59729.ENSTGUP00000008213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]