SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008215 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008215
Domain Number 1 Region: 207-341
Classification Level Classification E-value
Superfamily Cadherin-like 4.06e-30
Family Cadherin 0.00000725
Further Details:      
 
Domain Number 2 Region: 438-564
Classification Level Classification E-value
Superfamily Cadherin-like 1.09e-25
Family Cadherin 0.00058
Further Details:      
 
Domain Number 3 Region: 116-211
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-16
Family Cadherin 0.0000194
Further Details:      
 
Domain Number 4 Region: 2-63,95-131
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000157
Family Cadherin 0.0015
Further Details:      
 
Domain Number 5 Region: 551-658
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000286
Family Cadherin 0.0034
Further Details:      
 
Domain Number 6 Region: 327-442
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000104
Family Cadherin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008215   Gene: ENSTGUG00000007909   Transcript: ENSTGUT00000008300
Sequence length 858
Comment pep:known_by_projection chromosome:taeGut3.2.4:20:10993720:11156314:-1 gene:ENSTGUG00000007909 transcript:ENSTGUT00000008300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKFNNCAGNKGVRYETNSLDFKVRADGTLYAAHHLQLPSKQLILVVTAWDPQSLGRWEAM
VRFLVAEKSQHNGHKPKGRKALPGELVQQQSDTLLPWRQHQSANGLRRQKRDWVIPPINV
PENSRGPFPQQLVRIRSDKDKEIHIRYSITGVGADQPPMEVFNIDPVSGRMYVTRPMDRE
ERASYHLRAHAVDMNGNKVENPIDLYIYVIDMNDNRPEFINQVYNGSVDEGSKPGTYVMT
VTANDADDGTTANGMVRYRIVTQTPQSPSQNMFTINSETGDIVTVAAGLDREKVQQYIVI
VQATDMEGNLNYGLSNTATAIITVTDVNDNPPEFTTSTVRGEQPQKGVRTSVVTTRDLTG
RQAGSRNWGGMGLPTTTCTHSHFSFSPAKGPREKIQHFAAAVDYEMNRAFMLTVMVSNQA
PLASGIQMSFQSTAGVTISVTDVNEAPYFPTNHKLIRLEEGVPTGTVLTTFSAVDPDRFM
QQAVRYSKLSDPANWLNINATNGQITTAAVLDRESDYIKNNVYEATFLAADNGIPPASGT
GTLQIYLIDINDNAPELLPKEAQICEKPNLNVINITAADADIDPNVGPFVFELPSVPSAV
RKNWTITRLNGDYAQLSLRIMYLEAGVYDVPIIVTDSGNPPLYNTSVIKVKVCPCDENGD
CTTIGAVAAAGLGTGAIIAILICIIILLTMVLLFVVWMKRREKERHTKQLLIDPEDDVRD
NILKYDEEGGGEEDQDYDLSQLQQPETMDHVLNKTPGVRRVDERPIGAEPQYPIRPVIPH
PGDIGDFINEGLRAADNDPTAPPYDSLLVFDYEGSGSTAGSVSSLNSSSSGDQDYDYLND
WGPRFKKLADMYGGGEED
Download sequence
Identical sequences H0ZCA6
ENSTGUP00000008215 ENSTGUP00000008215 59729.ENSTGUP00000008215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]