SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008222 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008222
Domain Number 1 Region: 694-751
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.03e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 3-44
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000017
Family Somatomedin B domain 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000008222
Domain Number - Region: 39-111
Classification Level Classification E-value
Superfamily E set domains 0.000168
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008222   Gene: ENSTGUG00000007968   Transcript: ENSTGUT00000008308
Sequence length 751
Comment pep:novel chromosome:taeGut3.2.4:15:5851366:5860827:-1 gene:ENSTGUG00000007968 transcript:ENSTGUT00000008308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAQDSCAHRCGELLGTCSCQVTCQSLGICCPDYKEFCLQISPYSGSLLGGKDFLINNTAF
DASSGLKCRFKKKIITSGYIDKDGKAHCISPLLYETGFIPFEVSTDDGLTFPYSGTWLSV
HHNKVSDEEKCTLVNETKWQYYGTPNTGGNLTLTWTHQTLAATQVNIEVWGYQETGDSYS
ENWMAEWKYLYTLAREIPNTGKYSFVPVPAKGNYSTWDYGILRIIPNSYSDGQNIPSIWS
SDHALAWHLEKDFRNDPNAWATAKCIEWDRKEDLLPNFIEEIIDCPCTLAQARADTGRFH
TDYGCDIEKGSVCTYHPGAVHCVRGIQASPKYGAGQQCCYGSTGTQILTHDSTGGSTPDR
GHDWGSPPFLKPPRIPGFSHWLYDVISFYYCCLWSDNCDFYMKRRPSSDCRTYRPPRAAS
AFGDPHFLTFDGLNFTFNGLGEYTLVESDLTSLRVQGRTQQAHFSNGTGARGTGLSAVAM
QENNSDVIEVRYSEDLHLEVLLNQRVLSFSEQTWMDLKGLFLYSTPDQNITVMFSSGSGV
EIRGSGGFLTLTILLPEKFMNHTWGLFGVMNGNPEDDYTFKNKTTMSVHASPQQVFEFGA
SWAVKNGTSLFTYDTEFLLDSFFYGDKHNASFLPVFSPHEDPADPLLEEMASRCGSDPFC
RFDVLTTRSLQVGSSTRLSHQKHKLLVEHLEPVISCGWLDHPTNGRKNATNYLLGSVINF
TCNEGYELTGSQERTCQASGTWSGDTPQCSP
Download sequence
Identical sequences H0ZCB2
ENSTGUP00000008222 ENSTGUP00000008222 59729.ENSTGUP00000008222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]