SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008228 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008228
Domain Number 1 Region: 130-207
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000181
Family Ubiquitin-related 0.077
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000008228
Domain Number - Region: 53-96
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00137
Family UBX domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008228   Gene: ENSTGUG00000007981   Transcript: ENSTGUT00000008314
Sequence length 415
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:86015362:86107942:-1 gene:ENSTGUG00000007981 transcript:ENSTGUT00000008314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRMKARAPPPPNQPSAASRIHSEPKSPAETAVISDQNLVSMKENMINRLVDFTVVLPSGV
EQKCTVQGSKAVMDVLVDLCSQYHLNPSQHSLELKSSGTQQVLSYKPNTLIGALDVQTVL
LKEKIAEEKAKRPLPRVPEKSVRLVVNYLKTQKAVVRVSPEVPLHNIIPAICEKCEVSQE
HIVLLRDGITGEELELTKSLEELGIKELYAWDRKKEPNRKASVSSDAIEKEKTRLLGLFN
ADRSSNKGFSTAPNSPSVNSRSSSLGSSQSLGNISGMTANPEVKKRRAPPPPVATPVLPN
ANAETVKLTSLNDLRKKKRRAPLPPAASAPPTPAMPNRTEDREDKRRSTMESLLSTHDNV
YVVDDTVLELSEVEETASESSCFASEDTTEDSGVVSSPSDIVSLDSQHDNMKLRD
Download sequence
Identical sequences H0ZCB8
ENSTGUP00000008228 ENSTGUP00000008228 59729.ENSTGUP00000008228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]