SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008287 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008287
Domain Number 1 Region: 74-205
Classification Level Classification E-value
Superfamily Cadherin-like 4.97e-30
Family Cadherin 0.000042
Further Details:      
 
Domain Number 2 Region: 299-424
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-25
Family Cadherin 0.00014
Further Details:      
 
Domain Number 3 Region: 192-304
Classification Level Classification E-value
Superfamily Cadherin-like 7.07e-18
Family Cadherin 0.0000822
Further Details:      
 
Domain Number 4 Region: 11-86
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000143
Family Cadherin 0.0000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008287   Gene: ENSTGUG00000008034   Transcript: ENSTGUT00000008374
Sequence length 429
Comment pep:known_by_projection chromosome:taeGut3.2.4:11:11663149:11665377:1 gene:ENSTGUG00000008034 transcript:ENSTGUT00000008374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIKSNKDKETKVFYSITGQGADTIPVGVFIIERETGWLEVTKPLDREEKDKYVLYSHAVS
ANGQPVEDPMEIIITVTDQNDNRPVFTQQVFVGYIEENAKPGTSVMTVNATDADDAINVN
NGIIGYSILSEEPKGAQRMFTINAEKGIISVIGTGLDRETTPNYTLIIQAADQEGTGLTN
TATAIIKVTDANDNPPVFNPATPSWHKPPPGVGVLVTRLHVTDQDLPGSPAWRAVYRIQS
GDPQGDFEITTDPKTNDGLLKTAKGLDYETQDRYKLVVSVENEAPFTVALNPATANVLVV
VTDVNEAPIFNPPVKQVEVMEDVPVGYQVTSYTAQDPDKDQRQKITYRMGSDPAGWLAID
AENGIVTAAQPLDRESAHAINSTYKAIILAIDNGSPNYATGTGTLILLLQDVNDNGPVPE
PRNFDICNR
Download sequence
Identical sequences H0ZCH7
ENSTGUP00000008287 59729.ENSTGUP00000008287 ENSTGUP00000008287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]