SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008306 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000008306
Domain Number - Region: 32-85
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0978
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008306   Gene: ENSTGUG00000008064   Transcript: ENSTGUT00000008393
Sequence length 100
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:44983433:44983888:-1 gene:ENSTGUG00000008064 transcript:ENSTGUT00000008393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKYGYYHCKACNIRWESAYVWCVQGTNKVYFRQFCRTCQKSYNPYRVEDITCQSCKQTRC
TCPVKMRHVDPKRPHRQDLCGRCKGKRLSCDSTFSFKYII
Download sequence
Identical sequences H0ZCJ6 U3JKK4
59729.ENSTGUP00000008306 ENSTGUP00000008306 ENSTGUP00000008306 ENSFALP00000003308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]