SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008308 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008308
Domain Number 1 Region: 293-401
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 4.3e-36
Family Transforming growth factor (TGF)-beta 0.0000695
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008308   Gene: ENSTGUG00000008066   Transcript: ENSTGUT00000008395
Sequence length 401
Comment pep:known_by_projection chromosome:taeGut3.2.4:6:17062721:17073303:-1 gene:ENSTGUG00000008066 transcript:ENSTGUT00000008395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQDMIAVHRDKLYDKYNREGSRPADGNTVRSFKARPEFLAQKPLYCFNLTSMQDSEMILA
ATFHFYADKRPRHREVFCKRSKNSSCRLLHLPPVLQLNLVFQSIHQNSAYGLVKGNITVL
LQRRGAWHAKDISHIVKESKRAGELILCAELDSGEKHQGFPEQVASHLPYILVYANDLAI
SEPNSVAGTLQRYDPFPPNDGDPNLSPNASTDTRVRRDTNLASSIQNNELPEVDYNNKYN
KHDIWENAYRSLKPKASRKDRRRKGQENTETLKKSQVLNFDERTMKKARRKQWNEPRICS
RRYMKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVKAVGIIPG
IPEPCCVPDKMSSLSVLFLDENKNVVLKVYPNMSVETCACR
Download sequence
Identical sequences H0ZCJ8
ENSTGUP00000008308 ENSTGUP00000008308 59729.ENSTGUP00000008308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]