SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008337 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008337
Domain Number 1 Region: 103-192
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.45e-26
Family Platelet-derived growth factor-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008337   Gene: ENSTGUG00000008080   Transcript: ENSTGUT00000008424
Sequence length 353
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:16956279:16985864:1 gene:ENSTGUG00000008080 transcript:ENSTGUT00000008424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKPWATVNIFIISFLHLLQGSDYENGSVKRTSLSALERSEQQIRRASSLEELLHITHSE
DWKLWKCRLKLKSLANLDSRSASHRSTRFAAAFYDIDTLKVIDEEWQKTQCVPRETCVEV
AKELGTTTNKFFKPPCVNVFRCGGCCNEESLSCMNTSTTYVSKTLFEISVPLTSVPEPVP
IKIANHTACKCTSNTQRHQYTIIRRSVQYPEEDGCPFTNKFCHNGWIWDSDKCECVIDTQ
HSNRREGLPPLAELAMCGQHMEFDEENCECICRHKCPTDFFQSKENCSCYLCRESQESCA
LKHKIFHAETCSCEDRCPSQPRTCPTAKPVCSRHCRCPKEKRGSHGSQSRETP
Download sequence
Identical sequences A0A218UMM6 H0ZCM6
59729.ENSTGUP00000008337 ENSTGUP00000008337 ENSTGUP00000008337 XP_002197500.2.42559 XP_021388028.1.53032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]