SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008343 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008343
Domain Number 1 Region: 132-238
Classification Level Classification E-value
Superfamily Second domain of FERM 3.53e-32
Family Second domain of FERM 0.00038
Further Details:      
 
Domain Number 2 Region: 239-342
Classification Level Classification E-value
Superfamily PH domain-like 4.43e-28
Family Third domain of FERM 0.0046
Further Details:      
 
Domain Number 3 Region: 38-129
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-18
Family First domain of FERM 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008343   Gene: ENSTGUG00000008093   Transcript: ENSTGUT00000008430
Sequence length 344
Comment pep:novel chromosome:taeGut3.2.4:6:17262346:17268035:-1 gene:ENSTGUG00000008093 transcript:ENSTGUT00000008430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSGPEFIILSSEPPVTLQLPGSIVTKTTKKGKSYLSQRDLNVILLNGQCLEVQCDIKTKA
RDVFNTVVAYANLVEHFYFGLAYLKGKEFFFLDEETKLYKVAPDGWNDQPKKKMSIINFT
LFLRIKFFVNHFNVIQHGLTRHQFYLQLRKDILEERLYCSDETALKLGALALQAELGNYA
SEMHGKSYFRVEDYVPASRIEKMTLAYVQRELAKLHRMNRSLFEDEAELEFLKVTQQLPE
YGVLFYRVSQEKKGTEGDIILGICAKGIIVYENKNQTRIASLRFQWRETERISAHRKKFM
IESSFSGKKHTFITDTAKTCKYLLDLCSAQHKFNAQMNSRQLRQ
Download sequence
Identical sequences H0ZCN2
ENSTGUP00000008343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]