SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008353 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008353
Domain Number 1 Region: 168-310
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-39
Family Third domain of FERM 0.00052
Further Details:      
 
Domain Number 2 Region: 66-170
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-33
Family Second domain of FERM 0.00013
Further Details:      
 
Domain Number 3 Region: 2-63
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.89e-20
Family First domain of FERM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008353   Gene: ENSTGUG00000008100   Transcript: ENSTGUT00000008440
Sequence length 648
Comment pep:novel chromosome:taeGut3.2.4:2:89391590:89481213:-1 gene:ENSTGUG00000008100 transcript:ENSTGUT00000008440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNAKGQELFDQIVYHLDLVETDYFGLQFMDASQITHWLDHSKFIKKQIKIGPPYTLHFRI
KYYSSEPNNLHEEFTRYLFVLQLRQDILSGKLKCPYETAVELAALCLQAELGECEHPEHT
PELVSEFRFAPNQTEAMEFDIFQKWKECRGKSPAQAELCYLNKAKWLEMYGVDMHVVKGR
DGCEYALGLTPTGILIFEGANKIGLFFWPKITKMDFKKSKLTLVVVEDDEQGREQEHTFV
FRLDSAKTCKHLWKCAVEHHAFFRLRAPANSKSSRSDFIRLGSRFRFSGRTEYQATHGTR
LRRTSTFERRPSKRYPSRRHSTYKGVPLNPLNVASQSAKSTPEVHNYQPQYHPNIHPAQP
HWHPHTPVNVSYPLNNSDLHPFNIEENGGTPYTTKMAARHHHHHRHHHHHANYGALAPES
KDIVSAVPNPTSKSTAKKLSSGLPLLYDETSHLKKIETESMKVVGPWPALHVSMNKAEEK
KVPEKTLHAPVSPSSVPDHLKCNILKAQVEAAFRVGAQAVKEETSFVNPSKTSSLQDPNV
RSPAPVRPETTPTTVPTEKQEVKAPRVRKLTRQYSFDEDDLPPALAAAAAASTPVSSASP
GSQKTCTPQTSEGQTQVSPSGKSSTDAGSTFALEPGDLLMDFTEATPM
Download sequence
Identical sequences H0ZCP2
ENSTGUP00000008353 ENSTGUP00000008353 59729.ENSTGUP00000008353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]