SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008379 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008379
Domain Number 1 Region: 4-138
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-39
Family Galectin (animal S-lectin) 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008379   Gene: ENSTGUG00000008132   Transcript: ENSTGUT00000008466
Sequence length 144
Comment pep:known_by_projection chromosome:taeGut3.2.4:14:12540015:12541292:1 gene:ENSTGUG00000008132 transcript:ENSTGUT00000008466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLQFEALHPEGICPGWSIVVKGETSSRSSMFEINLLCEPGDQIALHFNPRLSSSRIVCNS
FLNSHWGQEEVNSTFPFKAKEPFQVEIYSDQDYFHVFINENKVLQYQHRQKNLSSITKLQ
ILDDIDISSVEITKRVLSWAHGEC
Download sequence
Identical sequences H0ZCR8
ENSTGUP00000008379 ENSTGUP00000008379 59729.ENSTGUP00000008379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]