SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008394 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008394
Domain Number 1 Region: 630-911
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.11e-99
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000716
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-34
Family Third domain of FERM 0.00016
Further Details:      
 
Domain Number 3 Region: 112-217
Classification Level Classification E-value
Superfamily Second domain of FERM 1.09e-33
Family Second domain of FERM 0.00021
Further Details:      
 
Domain Number 4 Region: 507-601
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-21
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 5 Region: 27-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.25e-20
Family First domain of FERM 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008394   Gene: ENSTGUG00000008110   Transcript: ENSTGUT00000008482
Sequence length 919
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:89689676:89779145:-1 gene:ENSTGUG00000008110 transcript:ENSTGUT00000008482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSRLRALGGRINNIRASELPKEKTRSEIICNVHFLDGSVQSFKVNKQDTGQILLDMTYN
QLGVTEKEYFGLQQNETSVDSPRWLEPSKPIRKQLKGGFPCTLHFRVRFFIPDPNTLQQE
QTRHLFFLQLKIDIAEGRLSCPISSAVVLASYAVQSQLGDYNASVHCSGYLSNYNFIPEQ
NKDFLTKVETLHEQHSGLKQSEAESCYINIARTLEFYGVELHSGRDLHNLDLMIGIASGG
IAVYRKLICTSFYPWVNILKISFKRKKFFIQQRQKHNESREHIVAFNMLNYRACKNLWKS
CVEHHTFFQGKKSLPHEKKILSHYWTLGSRNPAKSVNNQYCRKVIGGMVWNPSMRRSLSV
EHLETKSLPSRSPPVTPNWRSPRLRHEIRKPRHSSVDNLTNEISYITETEDVFYTYKGSP
TSKDSDSEFSQNRSPQRRNVLGNSPTRSSLTHLSPKALARSPNGVGNISGSYPLEGVDKQ
FLETYDDLTKSSSMEDSSQYYCDKNDLIEGDLLLVRIIPDEEGKFGFNLKGGVDQKMPLL
VSRITPGSPADKCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHTRELALLVRR
KVVKQFVEPISEDEADSLTLPESILPVCSEYGGDTLEESMEQLRRGLESGTVLIQFEQLY
RRKPGLAVTCAKVPQNMDKNRYKDVLPYDATRIILQGDEDYINANYVNMEIPSAGIVNRY
IATQGPLPHTCAHFWQVVWDHKLSLIIMLTTLTERGRTKCHQYWPDPPDVMEYGCFRVRC
HSEDCTIAYVVREMVITNIETEQQHTVTHLQYVAWPDHGVPDDSMDFLEFVTCMRPKRVK
NEPVLVHCSAGIGRTGVLVTMETAMCLIERNQPVYPLDIVRKMRDQRAMMVQTSSQYKFV
CEAILRVYKEGLVRPLDSS
Download sequence
Identical sequences H0ZCT3
59729.ENSTGUP00000008394 ENSTGUP00000008394 XP_012427295.1.42559 ENSTGUP00000008394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]