SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008421 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008421
Domain Number 1 Region: 40-346
Classification Level Classification E-value
Superfamily L domain-like 8.42e-47
Family Ngr ectodomain-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008421   Gene: ENSTGUG00000008172   Transcript: ENSTGUT00000008509
Sequence length 352
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:43265876:43271422:-1 gene:ENSTGUG00000008172 transcript:ENSTGUT00000008509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILKVCTSLLLLFSVNSAWTRTVRQVYDDLDPGHWSHYTSECPQECFCPPSFPNALYCDN
KGLKEIPPIPARIWYLYLQNNQIEKISEKPFANATHLRWINLNKNKITNSGIESGVLSKL
KRLLYLFLEDNELDEVPAPLPVGLEQLRLARNKISKIPEGAFSHLENLTMLDLHQNSLLD
SALQSDTFQGLNNLMQLNIAKNSLKKMPLSIPANTLQLFLDNNSIEVIPENYFSAIPKVT
FLRLNYNKLSDDGIPPNGFNVSSILDLQLSHNQLTKIPPINAHLEHLHLDHNKIKSVNGT
QICPVSIALEEDYGYYGNIPRLRYLRLDGNEIQPPIPLDIMICFRLLQAVVI
Download sequence
Identical sequences H0ZCW0
ENSTGUP00000008421 XP_002188571.1.42559 59729.ENSTGUP00000008421 ENSTGUP00000008421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]