SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008441 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008441
Domain Number 1 Region: 60-194
Classification Level Classification E-value
Superfamily BAG domain 6.02e-51
Family BAG domain 0.00000416
Further Details:      
 
Domain Number 2 Region: 14-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000189
Family Ubiquitin-related 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008441   Gene: ENSTGUG00000008182   Transcript: ENSTGUT00000008530
Sequence length 194
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:90741522:90751405:-1 gene:ENSTGUG00000008182 transcript:ENSTGUT00000008530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NEKHSIQVASQREDGEPTLQDMAVLIEQVTGVPVPFQKLIYKGKSLKELEQPLSALGVKN
GCKVMLIGKRNSPEEEAELKKLKDLEKSVEQIANKLEEVNKEFTSIQKGFLAKDLQAEAL
KQLDKRIKGTAEQFMKTLEQIDAINLPENFSDCKLKKKGLVKRVQVFLAQCDTIEGNIGQ
EMDKLQSKNLALAE
Download sequence
Identical sequences H0ZCY0
59729.ENSTGUP00000008441 ENSTGUP00000008441 ENSTGUP00000008441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]