SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008444 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008444
Domain Number 1 Region: 318-603
Classification Level Classification E-value
Superfamily BEACH domain 1.96e-121
Family BEACH domain 0.0000000457
Further Details:      
 
Domain Number 2 Region: 721-964
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.86e-24
Family WD40-repeat 0.0035
Further Details:      
 
Domain Number 3 Region: 170-295
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-21
Family PreBEACH PH-like domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008444   Gene: ENSTGUG00000008169   Transcript: ENSTGUT00000008533
Sequence length 966
Comment pep:novel chromosome:taeGut3.2.4:6:17558414:17632129:1 gene:ENSTGUG00000008169 transcript:ENSTGUT00000008533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVSCMERYRRVGQELYASLYKDHVQMQQCAYSKAAKDWMILEEQLFYRGGPWRDSSQSLE
PRWILDCYEGPSRMRRRIQHVNTQVEKAFAGGPQCLSHNFNSLACFLQINNAISQGELML
KGAEREMDQTGVDCNQLTFFPALHESFHSEDFLELCVERHIILQEFAENEKVTFKCSVAV
VQGHTALEGVLLFGKEHFYICECFVLSLLEEVYCTRHCLSRISDPFIFNLCHKDHAVGDQ
MCSRYSYHDIKEIHLMRFLLQEIALEIFFKNGYSRFLVFHDSDRNKIFKRFCSFQPALKS
KGITEESLNIRRHSGGEKTMLQKWQKREISNFDYLMYLNTLAGRSYNDYMQYPVFPWVLA
DYHSETLNLTDPHTFRDLSKPMGAQTVERKHKFIQRFNEVEKSEGDLSAQCHYCTHYSSA
IIVASYLVRMEPFTQTFCSLQGGSFDVADRMFHSVKSTWESASRDNMSDVRELTPEFFYL
PEFLTNANHFELGCMQDGTVLGDVQLPPWADGDPHKFIFLHRQALESDYVSAHLHRWIDL
IFGHKQHGSAAVEAVNTYHPYFYGDKMDLNNIKDPLIKGTILGFISNFGQIPKQLFTKPH
PSRNAQGKSAAGRETGLFLHSSGILPPFVSSLQNLKLTPVAIKELNISSVLPDYPKGAIG
HIVHTEKGILAVEKNKILIPPLWSKTFCWGFEDFTCCFGTYGSEKNVTTFECMADWGKCL
CAVCPSATTIITSGTSSVVCVWEFSLVKDKVKYLNLRQALYGHTQAVTCLAASVAYSIFV
SGSDDRTCIIWDLNRLTFIKQLPAHQESLRSLAINNSTGDIVSCAGSCLYLWTVNGQLLA
STSTACSPTCHIVCCCFAEVMDWDTRSIIITGSTDGVVRVGEWERGKGILIHSPCSEGEM
AWAPGARSNKCGKHLVLCRELNPSVALTGKASRTSPAVTALAVSRNSSKILVGDDWGRLC
CWSVDG
Download sequence
Identical sequences H0ZCY3
59729.ENSTGUP00000008444 ENSTGUP00000008444 ENSTGUP00000008444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]