SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008476 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008476
Domain Number 1 Region: 768-1015
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.31e-80
Family Eukaryotic proteases 0.0000748
Further Details:      
 
Domain Number 2 Region: 431-552
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.19e-35
Family Frizzled cysteine-rich domain 0.00013
Further Details:      
 
Domain Number 3 Region: 121-232
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.96e-29
Family Frizzled cysteine-rich domain 0.00066
Further Details:      
 
Domain Number 4 Region: 632-671
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 364-396
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 557-594
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000641
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 250-287
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000733
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 327-361
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000103
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 9 Region: 285-323
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000511
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 10 Region: 598-630
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 11 Region: 687-771
Classification Level Classification E-value
Superfamily SRCR-like 0.000016
Family Hepsin, N-terminal domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008476   Gene: ENSTGUG00000008187   Transcript: ENSTGUT00000008566
Sequence length 1022
Comment pep:novel chromosome:taeGut3.2.4:4:45231933:45322051:1 gene:ENSTGUG00000008187 transcript:ENSTGUT00000008566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLGTDEDDMGDGCSQKLASAKFLRLLLLILIPCICALILLLVILLTFVGVLEKTCFYSNG
SEGLTVNGDFETSPDLLPNMVENSSETDPTVDLSTQPSSWTTTPLSHIDQMNNNSNIFRE
NITNSQCQMLPYNYTTVTSVLSIVKSIEMEKFLKFFSYLNRLNCYQHIMLFGCSLALPEC
ISDGDDSLGLLPCRTFCEAAKEGCEPVLGMVNASWPDFLKCSQFQNKTENDTTTRVCFSP
HQEKGKQSLCGGEESFLCASGICIPRKLQCNGYNDCDDWSDEIHCNCSDDVFRCDTGKCL
NYTFVCDGYDDCGDLSDEQNCDCNPVTHHQCGEGRCITADWVCDGDHDCIDKSDEINCSC
HSQGLVECRNGQCIPSAFQCDGDNDCKDGSDEENCSENQTLCQEGDQRCSSCPDPCGTSP
CEMRNSQANCSQCEPITLELCMNLPYNYTYYPNYLGHRTQKEASISWESSLFPALVQTNC
YKYLMFFACTILVPKCDPHTNQRIPPCRTLCVQSKERCEAVLGIVGLQWPEDTDCTQFPD
ENSDNQTCLTPDEDVEECSPSHFKCRSGRCVLASRRCDGQADCEDDSDEDSCGCRERGLW
ECPLKKLCIRHTMICDGFPDCPDMMDEKNCSFCDESELECANHECVPRELWCDGQADCSD
SSDEWDCVTLSKNTNSLMLLTVHRSAADNHVCADEWQENLSQLACNQMGLGGPSKTEIVI
ESEQMQDQNWLNLHPDWKNKNASTLHALLVNGQTCQSRSKVALFCTKEDCGRRPAARMSK
RILGGRTSRPGRWPWQCSLQSEPSGHVCGCVLIARRWVLTVAHCFEGRENAAVWKVVFGI
SNLDHPSSFMQTRLVKTIILHPRYNRAVVDYDISIVELDEDINETSYVRPVCLPSKSQLV
QPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEQCQSYFDMKIITSRMLCAGYESGTVDS
CMGDSGGPLVCEHTAGRWTLFGLTSWGSVCFSKVLGPGVYSNVSHFIEWIERQIYIHTFL
LN
Download sequence
Identical sequences H0ZD15
59729.ENSTGUP00000008476 ENSTGUP00000008476 ENSTGUP00000008476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]