SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008489 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008489
Domain Number 1 Region: 144-451
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.03e-98
Family Protein kinases, catalytic subunit 0.000000000083
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily PH domain-like 8.4e-22
Family Pleckstrin-homology domain (PH domain) 0.00000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008489   Gene: ENSTGUG00000008212   Transcript: ENSTGUT00000008580
Sequence length 479
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:32408753:32540850:-1 gene:ENSTGUG00000008212 transcript:ENSTGUT00000008580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFAGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
Download sequence
Identical sequences A0A1D5NTY9 A0A1V4JKN4 A0A218V273 A0A2I0MTK2 H0ZD28
ENSGALP00000031235 59729.ENSTGUP00000008489 ENSTGUP00000008489 ENSTGUP00000008489 XP_002189920.1.42559 XP_005017999.2.99704 XP_005018000.1.99704 XP_005043330.1.66865 XP_005146075.1.78019 XP_005232527.1.75256 XP_005416286.1.5688 XP_005436621.1.10750 XP_005489768.1.73095 XP_005508733.1.63277 XP_005530647.1.90289 XP_008492210.1.100939 XP_008638177.1.15636 XP_008934782.1.37566 XP_009072608.1.14518 XP_009090216.1.15306 XP_009274335.1.47732 XP_009319531.1.49731 XP_009461774.1.38621 XP_009557940.1.62272 XP_009642989.1.23211 XP_009682365.1.43253 XP_009877408.1.31609 XP_009891946.1.48241 XP_009940462.1.35112 XP_009985939.1.11325 XP_010215047.1.20684 XP_010560899.1.12557 XP_011573197.1.59079 XP_013057329.1.65836 XP_014114838.1.90289 XP_014733553.1.99236 XP_014806323.1.91963 XP_015139467.1.86415 XP_015139468.1.86415 XP_017662202.1.3805 XP_017662203.1.3805 XP_017940599.1.51550 XP_019136791.1.2935 XP_021248056.1.32913 XP_021406101.1.53032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]