SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008516 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008516
Domain Number 1 Region: 478-604
Classification Level Classification E-value
Superfamily TIMP-like 4.97e-27
Family Tissue inhibitor of metalloproteinases, TIMP 0.026
Further Details:      
 
Domain Number 2 Region: 307-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000391
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 3 Region: 236-295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000023
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 4 Region: 370-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000265
Family Laminin-type module 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000008516
Domain Number - Region: 60-138
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0173
Family APC10-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008516   Gene: ENSTGUG00000008258   Transcript: ENSTGUT00000008607
Sequence length 604
Comment pep:novel chromosome:taeGut3.2.4:12:11204854:11239085:1 gene:ENSTGUG00000008258 transcript:ENSTGUT00000008607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RACNPPVGNLATGRTPVTTTTCGQNSTELYCFYPEQNLLQHASPGCGQPRCAKCNINQPD
NSHLPADMTDDFFANPISWWQSAQGVHREEIRLDFETEFYLTHVIAVFKSPRPAAMVLER
SQDYGQTWRPYKYFSVNCTATFGLQDDLVEEGSMCTSRYSDAVPCTRGEVIYRALSPANK
IEDPYSPEAQDLLKLTNLRLLLLKRQECPCHGSGLVEKPQRFAHYAIYDLIIRGSCFCNG
HAEEFLAPGSVGFLREPGSCVGIVHGKCVCRHNTAGDHCEKCAPLYNDQPWKPGDGKTGA
PNECRKCRCHNHAESCHFDLSVWLASGKRTGGVCDNCKHNTEGHRCQRCKPGFYRDRGKP
MSSPEVCKPCACQPLGSANATFSSSWRCHPRTGFCYCKPGVAGPSCDRCLVGYWGLGESG
CRPCDCARDCDQRTGTCFNGCLFVGWFVSLPLLWFVSNESDEEWKWNDHEQGFSALRHPE
KCVCKEKVLGSVSDFCQMKYAYVIKARILSAHDKGTHAEVVVKVKKVLKSSKVKIARSNR
SIYPESWTNRGCTCPILNPGTDYLIAGQEDSRTGKLLVNMNSLVKPWKAHLGKQVSDILR
TGCK
Download sequence
Identical sequences H0ZD55
ENSTGUP00000008516 ENSTGUP00000008516 59729.ENSTGUP00000008516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]