SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008530 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008530
Domain Number 1 Region: 279-406
Classification Level Classification E-value
Superfamily Second domain of FERM 5.63e-32
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 408-512
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-25
Family Third domain of FERM 0.0059
Further Details:      
 
Domain Number 3 Region: 33-143
Classification Level Classification E-value
Superfamily PDZ domain-like 2.35e-16
Family PDZ domain 0.012
Further Details:      
 
Domain Number 4 Region: 190-272
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000517
Family Ras-binding domain, RBD 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008530   Gene: ENSTGUG00000008266   Transcript: ENSTGUT00000008621
Sequence length 1301
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:18426995:18537251:-1 gene:ENSTGUG00000008266 transcript:ENSTGUT00000008621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHRNKSSGWPHPSGTWSLNQGTPYGWEMTANRDGRDYFISHMTQSATFEDPRIESCQITP
PTPRKVEMRRDPVLGFGFVAGSEKPVVVRSVTPGGPSEGKLIPGDQIIMINDEPVSTAPR
ERVIDLVRYCKESILLTVVQPYPSPKSAFISAAKKARLKSNPVKVRFSEEVIINGQVSET
VKDNSLLFMPNVLKVYLENGQTKSFRFDCSTSIKDVILTLQEKLSIKCIEHFSLMLEQRV
EGSGTKLLLLHEQETLTQVTQRPGSHKMRCLFRISFVPKDPIDLLRRDPVAFEYLYVQSC
NDVVQERFGPELKYDIALRLAALQMYIATVTTKQTQKISLKYIEKEWGLETFLPSAVLQS
MKEKNIKKALSHLVKANQNLVPPGKKLSALQAKVHYLKFLSDLRLYGGRVFKATLVQGEK
RSEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEMFTEDESNVRVELHVLDVKPIT
LLMESSDAMNLACLTAGYYRLLVDSRRSIFNMANKKNAGSRETGPENRGQHNILASEWNC
IPKTTTFLAEGDQEAQMSFADPKQKTIDVSESLLCQKEHRHLYIENTYNSGGFDQHLAKQ
NDPAETEESRNFNQPSLLSLSGLEPSKKAQDSPRGAKVSFIFGDPNLDGISPQTLGYERL
LDESPEVLEKQRAIYLSNANDIKGLELSPDAESIQFATNSVYATISDGKIFGAAEGIEEP
LLHDICYAENTDDAEDEDEVSCEEDIMVGEISRPPLLSLSGSSDDIIDLTSLPPPEGDDN
EDDFLLHTLNMAIAAPPPGFRDSSDEEDSQNQATQPRNNKEQDSNLGNDDIPVSLIDAVP
TNTEGKCEKGLDDAVVSTLQALEALAASEEQQTNDNSGVAILRAYSPESSSDSGNETNSS
EMTESSELAAAQKQSENTARMFLTTSEGYQPLVEEQTEFPIAKNQVGGPGMKPSQPLGGQ
DAELQSKVVPSKQILHSDNMEMEPETMETKSVTDYFSKLHMGSLVYSCTSKRKNKMTDSE
VKASSDGNATVKKQQGNKKAESDEDLKAKFGTLSARDSQRLSTFNVERTAFRQRWYAADD
GAADKPSPETVNGKTFPRVPVLGKTETDCKGEVDPEVDQDDTSGLSQGENFLSDMTPVSS
AKDLNDAEDTDLSADDHPSKLPEAEQSVARLCEYHMAKRMSSLQSEGHFSLQSSQCSSVD
AGCSTGSSTCATPVESPLCTSDGKHIISDPSMKGIAYVPADERAAILPNHGTTFKDLHQQ
PEAVCHRMTMPVVHSAVNAEPLFGTLREGCHRIPKIKETTG
Download sequence
Identical sequences H0ZD69
ENSTGUP00000008530 ENSTGUP00000008530 59729.ENSTGUP00000008530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]