SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008550 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008550
Domain Number 1 Region: 2-78,137-162
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000055
Family Chromo barrel domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008550   Gene: ENSTGUG00000008286   Transcript: ENSTGUT00000008641
Sequence length 491
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:18871103:18888774:-1 gene:ENSTGUG00000008286 transcript:ENSTGUT00000008641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIVDIVVGKDDKGRKIPEYLIHFNGWNRSWDRWAAEDHVLRDTDENRRLQRKLARKAVAR
MRRKGRKKRRCRLPGVDSVLKSLPAEENDESSENSISSSSSDDSDEGTDEEIKSEESDID
ERTEMKEEQDTHTKRDMEERAISIEIPEVLKKKLEEDCYYINRRKRLVKLPCQTNIITIL
ESYVKHFAINAAFSANERSRHHQMTPHANMNLHYVPPEKNVELCKEMVDGLRITFDFTLP
LILLYPYEQAQFKKVTSSKFFLPIKENSTTTNRNQEELSPSPPLLNPPTPQSTDSQPTTG
EPATPKRRKAEPEILQSLRRSTRHSSNCDRLSESSASPQPKRRHLETPASMPKLFLHLEK
KTPVHSGSSSPITLTPSKEGSTVFTGFEGRRNNELNEVLSWKLMPENYPPSDQPPPPSYI
YGSQHLLRMFVKLPEILGKMCFPDKNLKALVKHFEMFLRFLAEYHDDFFPESAYVAACEA
YYSTKNPRAIY
Download sequence
Identical sequences H0ZD89
59729.ENSTGUP00000008550 ENSTGUP00000008550 ENSTGUP00000008550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]