SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008609 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008609
Domain Number 1 Region: 478-658
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-50
Family SPRY domain 0.00081
Further Details:      
 
Domain Number 2 Region: 165-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.98e-17
Family B-box zinc-binding domain 0.000031
Further Details:      
 
Domain Number 3 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000114
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Domain Number 4 Region: 374-483
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000218
Family Fibronectin type III 0.002
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000008609
Domain Number - Region: 109-161
Classification Level Classification E-value
Superfamily RING/U-box 0.00318
Family ZZ domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008609   Gene: ENSTGUG00000008325   Transcript: ENSTGUT00000008700
Sequence length 667
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:19577555:19670138:1 gene:ENSTGUG00000008325 transcript:ENSTGUT00000008700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCATNEPVESITAFQCPTCR
YVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAFDNNSMSSCEKVLCQ
FCDQDPAQEAVKTCVTCEVSYCEECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHED
EKVNMYCVTDDQLICALCKLVGRHRDHQVAALSDRYDKLKQNLESNLTNLIKRNTELETL
LAKLIQTCQHVEVNASRQETKLMEECDQLIEIIQQRRQIIGTKIKEGKVVRLRKLAQQIA
NCKQCIERSTSLISQAEQSLKENDHARFLQTAKNITERVSMATASSQVLIPEINLNDTFD
TFALDFTREKKLLECLDYLTAPNPPTIREELCTASYDTITVHWTSDDEFSVVSYELQYTI
FTGQANVVSLCNSADSWMIVPNIKQNHYTVHGLQSGTKYIFIVKAINQAGSRSSEPGKLK
TNSQPFKLDPKSAHRKLKVSHDNLTVERDETSSKKSHTPERFTSQGSYGVAGNVFIDSGR
HYWEVVISGSTWYAIGISYKSAPKHEWIGKNSASWVLCRCNNTWVVRHNSKEIPIEPAPH
LRRVGILLDYDNGSLAFYDALNSLHLYTFDITFGQPVCPTFTVWNKCLTIITGLPIPDHL
DSSEQLA
Download sequence
Identical sequences A0A091EV23 A0A093Q308 H0ZDE7 U3JPI3
XP_002186604.1.42559 XP_005037462.1.66865 XP_005037463.1.66865 XP_005037464.1.66865 XP_005516680.1.90289 XP_008634112.1.15636 XP_008925060.1.51550 XP_008925060.1.96775 XP_010392684.1.2935 XP_014737905.1.99236 XP_014737906.1.99236 XP_014737907.1.99236 XP_014737908.1.99236 XP_014737909.1.99236 XP_014737910.1.99236 XP_014737911.1.99236 XP_015496553.1.82291 XP_015496563.1.82291 XP_015496573.1.82291 XP_015496580.1.82291 XP_015496587.1.82291 XP_016154468.1.66865 XP_016154470.1.66865 XP_016154473.1.66865 XP_017592648.1.15636 XP_017592649.1.15636 XP_017592651.1.15636 XP_017592652.1.15636 XP_017667848.1.3805 XP_017667849.1.3805 XP_017667850.1.3805 XP_017939876.1.51550 ENSTGUP00000008609 ENSTGUP00000008609 59729.ENSTGUP00000008609 ENSFALP00000004687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]