SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008611 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008611
Domain Number 1 Region: 54-236
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-26
Family SPRY domain 0.017
Further Details:      
 
Domain Number 2 Region: 265-435
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000297
Family Nucleotide and nucleoside kinases 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008611   Gene: ENSTGUG00000008309   Transcript: ENSTGUT00000008702
Sequence length 591
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:32852352:32863828:-1 gene:ENSTGUG00000008309 transcript:ENSTGUT00000008702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDGKTEQKPGEKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVVCL
DTYNCDLHFKISRDRFSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVKHLY
TKDIDIHEVRVGWSLNTSGMLLGEEEFSYGYSLKGIKTCNCETEDFGEKFDENDVIGCFA
NFDGDEVELSYSKNGQELGVAFKISKEVLDGRPLFPHVLCHNCAVEFNFGQKEEPYFPVP
EEYTFIQKVPLEDRVRGPKGPEQKKDCEVVMMIGLPGAGKTTWVTKHAAANPGKYNILGT
NTIMDKMMVAGFKRQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQR
RKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHASLTLLRNFTLPEVAECFD
EIIYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKNKKSNKNQFNRGQRGRGGFNM
RGNFRGGVPGNRGGYNRRGGNMPQRGGGGGGGGAIGYPYPRGPVFPSRGGYSNRGNYNRG
GMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY
Download sequence
Identical sequences H0ZDE9
ENSTGUP00000008611 ENSTGUP00000008611 59729.ENSTGUP00000008611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]