SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008671 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008671
Domain Number 1 Region: 101-341
Classification Level Classification E-value
Superfamily vWA-like 2.19e-72
Family Integrin A (or I) domain 0.00000133
Further Details:      
 
Domain Number 2 Region: 1106-1289
Classification Level Classification E-value
Superfamily Fibronectin type III 1.34e-37
Family Fibronectin type III 0.0000116
Further Details:      
 
Domain Number 3 Region: 1488-1687
Classification Level Classification E-value
Superfamily Fibronectin type III 1.65e-33
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 4 Region: 968-1091
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000131
Family CalX-beta domain 0.0013
Further Details:      
 
Domain Number 5 Region: 603-685
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000000837
Family Integrin beta tail domain 0.0019
Further Details:      
 
Domain Number 6 Region: 1-51
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000392
Family Plexin repeat 0.00091
Further Details:      
 
Domain Number 7 Region: 526-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Integrin beta EGF-like domains 0.036
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000008671
Domain Number - Region: 557-594
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000109
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Domain Number - Region: 442-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00781
Family Integrin beta EGF-like domains 0.025
Further Details:      
 
Domain Number - Region: 478-514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0109
Family Integrin beta EGF-like domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008671   Gene: ENSTGUG00000008343   Transcript: ENSTGUT00000008763
Sequence length 1698
Comment pep:known_by_projection chromosome:taeGut3.2.4:18:8335309:8355568:-1 gene:ENSTGUG00000008343 transcript:ENSTGUT00000008763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NRCVLSRAKSCTECIRVDKDCSFCTDESFEEPRCDLRENLLRSGCGEASIVYTQGEMRTL
KNSSINVSLQRTQVSPQAMYMRLRAGEEMSFNMDVFQPKESPVDLYILMDFSYSMSDDLD
NLKSMGHNLADFLQALTSNYTIGFGKFVDKVSSPQTDMRPEKLREPWHNADSPFSFKNVI
RLTSNINHFSQELSKERISGNLDAPEGGFDAILQTAVCKDKIGWRKDSTHLLVFSTESAF
HYEADGTNVLAGILARNDEQCHLDSHGTYVYDTKQDYPSVPTLVRLLGQHNIIPIFAVTN
HSYSYYEKLHKYFPISEIGELQEDSSNIVELLRVAFERIRSKMDIRADFTPRALKTEFTS
PEFEKTESGSFNITRGKVSKFHMHVKALEYVGGQHVCSLPEKDRQGVIHVKPTSLSDSLT
VSTAVICDVCPCEQQQELDSPKCSFHGNFVCGQCICHPGWRGDTCDCSPASSPNNEACVR
PGDAEPCSGRGECLCGKCQCYSEEQSLRFDGAFCEFDVLQCPRTSGFLCNDRGRCSRGAC
VCESGWEGPGCECPTSNDTCIDSRGGICNNHGRCECGRCICDMASLYTSSTCEISYSLGF
QAVCESIRDCVRCQTWGTGNLKGNCSSCHLQVQLVEELRKEEAGEYCSFQDEDDDCTYHY
TLEGDPSVLPNTTVRVQKNKECPPGNFLWLIPLLIFLILLLGLLLLLCWKFCACCKACLA
LLPCCARGRTVGFKEDHYMLRQSLMSSDHLDTPLVRSGSLKGRDTVRWKIHNNVHKQGVT
SPAATKDLSECPLPYGLSLRLARLFTQNLMKTETREFEQLRKEVEENLNEVFKHIPGCHK
VQQTKFRLQPNSGKRQDHTIVDTVLTAPYSAKPDIIKVVEKHVSHEAFNDLKVAPGYYTV
TSDQDAQGMVEFQEAVELVDVRVPLFIRDDDDDEKQLQVEAIEVPNGIAKIGRRVVNITI
IKEQASSLITFLQPAYSHSRFDKLAKIPVLREIIDNGKSQVTYRTRDLTAKNGRDYIFTE
GELVFQPGETRKEVQVPLLELTEIDTLLNNCQLKQFAIDLLHPKYGAKIGRYPQTTVTIA
DPELVDGVPSMTGLAQVPQSPKGRLSAPLNPDARALSSREISFNWFPPPGKPLGYKVKYW
IQGDPESEAHLIDVKTPSAKLTNLYPFCDYEMQVCAYNAVGEGTYSDIIHCRTLEEVPSE
PGRLAFSLVSSTTTQLSWAEPAETNGVITAYEVGYGLVNEDNIPIGPVKKVLVEDPKKRM
VLIENLHESQPYRYTVKARNGAGWGPEREATINLATQPKRPMSIPIIPDVPIIDAEGGED
YDSYLMYSTDVLRSPAGSKRPSVSDDSEHLMNGRVDFSFPGSGSGTLTRTANTSYHQLSS
HMHQEHRVMGSSSLTRDYSTMLMGHGEYHRDGTCPSLPSPGPTLAGTLLPSIREDAGRTL
LRPRDVGFRSRAKVKGYYPSIGCRDSIIMTDGSTGMCKGFNSRKPLGIPDTPTRLVFSAL
GPTSLKVSWQEPRCEKEVQGYSVQYQLLNGGEVHRITIPNPSQNSVVVEDLLPNHSYIFK
VKAQSEEGWGPEREGVITIESQVDPQSPLSPVPGTPFTLSTPCAPGPLVFTALSPDSLHL
SWERPREPNGPILGYRITCERLHGGGEPRTIYVEGDNLETTLTVPHLSENVPYKFKVQAN
TTQGFGPEREGLITIESQ
Download sequence
Identical sequences H0ZDK9
ENSTGUP00000008671 59729.ENSTGUP00000008671 ENSTGUP00000008671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]