SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008727 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008727
Domain Number 1 Region: 142-233
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.64e-18
Family Thioltransferase 0.023
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000008727
Domain Number - Region: 237-295
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.000366
Family DnaJ/Hsp40 cysteine-rich domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008727   Gene: ENSTGUG00000008477   Transcript: ENSTGUT00000008820
Sequence length 295
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:46770029:46806381:-1 gene:ENSTGUG00000008477 transcript:ENSTGUT00000008820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKGEVKADSERLLRKVRFRVASSHSGRVLKEVYADGEAADSLDSEYASSSETDQTSRLS
EVDGQQNGHVGSECDENDNEQDDLLILVRATKEKGFGTKRVNILSKNGTVRGVKHKVSAG
QALFDNLAKVFQVVPSSLPEFGRIVIYTTSLRVVRTTFERCELVRKIFQNHRVKFEEKNI
ALNSDYGKELDERCRSVCELPSLPVVFIDGHYLGGAEKILLMNESGELQDLLTKIERVQH
PQECPSCGGFGFLPCSACHGSKMSVFRNCFTDSFKALKCTACNENGLQRCRTCAG
Download sequence
Identical sequences H0ZDR5
ENSTGUP00000008727 59729.ENSTGUP00000008727 ENSTGUP00000008727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]