SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008778 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008778
Domain Number 1 Region: 43-134
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.48e-26
Family Platelet-derived growth factor-like 0.0000997
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008778   Gene: ENSTGUG00000008526   Transcript: ENSTGUT00000008871
Sequence length 146
Comment pep:known_by_projection chromosome:taeGut3.2.4:14:13906590:13929996:1 gene:ENSTGUG00000008526 transcript:ENSTGUT00000008871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILFPVLGYDDVSETNLRSYSVHSAKHVQENRPVPIRRKRSIEEAIPAVCKTRTVIYEIPR
SQIDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRIHHRSVKVAKVEYVRKKPKLKEV
LVRLEEHMECTCTSSNTNSDYREEET
Download sequence
Identical sequences H0ZDW6
ENSTGUP00000008778 ENSTGUP00000008778 59729.ENSTGUP00000008778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]