SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008892 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008892
Domain Number 1 Region: 1046-1395
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.98e-94
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000372
Further Details:      
 
Domain Number 2 Region: 864-1043
Classification Level Classification E-value
Superfamily ARM repeat 1.98e-60
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000642
Further Details:      
 
Domain Number 3 Region: 359-527
Classification Level Classification E-value
Superfamily Ubiquitin-like 3e-38
Family Ras-binding domain, RBD 0.016
Further Details:      
 
Domain Number 4 Region: 683-847
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.23e-35
Family PLC-like (P variant) 0.023
Further Details:      
 
Domain Number 5 Region: 1425-1545
Classification Level Classification E-value
Superfamily PX domain 3.01e-29
Family PX domain 0.0012
Further Details:      
 
Domain Number 6 Region: 1562-1691
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.64e-23
Family Synaptotagmin-like (S variant) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008892   Gene: ENSTGUG00000008575   Transcript: ENSTGUT00000008987
Sequence length 1695
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:11420171:11456232:-1 gene:ENSTGUG00000008575 transcript:ENSTGUT00000008987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQISSSNGFKQRSSPSLSAPRSKDVDKEEALQMEAEALAKMQKERGVAGNKQTFHSLSS
PRQKAQAHNKQDHDLMVFPESDAKSMEDKLSTIDIEKLTHAELEKLLLDDNFESSKVPVL
PASPILSPSVSSQFYLGPAGQRRQWTPGIPAPVTCTLPPIYTSASYTKQTGVFQNGFHPS
MSSYPPREPIYLGLPRQSQYISYPVAATTPFHPHGALPLYPPVLTPEMAKVFDKIASTSE
FLRNGKSSTDLEMTSIKSAVSNLPASESCGDVSKFDWLDLDPLSKPKVDTVETLNKAEDD
GERASSMTAEDPWDAVLLEEKLLLPCHLERKVNGKSSGTTVTRSQSLNMRTTQIAKLQGQ
TSQKDNGTTGTLTENVRLQAIEGQNQELSAFSEAVTKLRTKFPYTDQQTNPGFVLSPIML
QRNISGESASIKVSIEIEEFQQPVTFTCDVSSPVELIIMQALCWVHDDLNEVDIGSYILK
VCGQEEVLQNKHCIGSHEYIQSCRKWDTDISLQLLTHSGMCSDLARTVNDDRTPVHLTKH
LYKVEKPFREPIIRSSIEELLEVYHKQVNIALKNENQHKAVDHVIKTVRKICSTLDCVET
PAITESVKKLRRAVNLPRIKNAEVSLKCGDDNSKSPSGSLKPLNPLKVSIDQLTRAVEAL
LQLHTNSCSSSAAISPEDSKSTKEAWTATEHLQFTIFAAHGISSGWVSNYEKYYLICSLT
HNGKDLFKPVQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESVLRLTLFGILNQSSGS
SPDSNKQRKGPENLGQVSLPLFDFRRLLTCGTKLLQLWTSSHPHHVSGMASKKGNMERIV
LQIDFPSHAFDIEYKIPQASKTTVHHSVETLEKPLRERLLAILSKDSTIGLSKEDKEFLW
EKRHYCHSHPNSLPKILVSAPHWDWASLPEIYSLLQSWPPLSPLAALELLDSKFADQEVR
NTAVNWIETLSDDELTDFLPQFVQALKYETYLDSALVKFLLARALGSIRIAHYLYWLLKD
TLYDTKFGVRYEQILGAFLSVCGKRLREELEKQTRLVQLFGMVAERVKQTSGSARQVALQ
NGMERVQLFFLKNKCRLPLNPSLVAKELNIKACSFFSSNAVPLKVALINADPLGEEINVM
FKVGEDLRQDMLALQMIKIMDKIWLQEGLDLRMVIFKCLSTGKDRGMVELVPASDTLRKI
QVEYGVTGSFKDKPLAEWLRKYNPTEEEYEKASENFIYSCAGCCVATYVLGICDRHNDNI
MLRNTGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTIRFQLFVDLC
CQAYNLIRKHASLFLNLLSLMLSSGLPELSGVQDLKYVQDALQPQTTDAEATIFFTRLIE
SSLGSVATKFNFFIHNLAQLRFSGLPSNDEPILSFSAKTYSLKQDGRIKQVSVFTYQKRY
NPDKHYIYVVRVLREGQVEPTFVFRTFDEFQELHNKLGILFPLWKLPGFPNKMVLGRTHI
KDVAAKRKVELNSYIQSLMNSSPEVAECDLVYTFFHPLLRDDKVEGIDGIARPADTSPSS
PTSGKVGGEVKLSISYRNSTLFVMVMHIKDLVTEDGADPNPYVKTYLLPDMHKTSKRKTK
ISRKTRNPTFNEMAKLVYSGYSMETLKQRELQLSVLSAESLRENFFLGGITLPLKDFNLS
KETVNWYRLTAVPYL
Download sequence
Identical sequences H0ZE80
59729.ENSTGUP00000008892 ENSTGUP00000008892 ENSTGUP00000008892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]